(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE97

ASFUM1_6.PE97        Location/Qualifiers
FT   CDS             join(354224..354265,354337..354474,354533..354625,
FT                   354684..354958,355010..356219)
FT                   /codon_start=1
FT                   /gene_family="HOG000202485" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263236"
FT                   /orf_name="AFUA_6G02100"
FT                   /product="DUF803 domain protein"
FT                   /protein_id="EAL85829.1"
FT                   /db_xref="HOGENOM:HBG056360"
FT                   /db_xref="HOGENOM:HBG327035"
FT                   /db_xref="InterPro:IPR008521"
FT                   /db_xref="UniParc:UPI000051F669"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCQ9"
FT                   /transl_table=1
FT                   /translation="MGNLGDLSPQGSVAVGVIVGLISTSLQAIGLTLQRKSHILEDEKH
FT                   PYDLRRPPYKRRRWQLGMLMFVVSNIVGSTIQITTLPLPVLSTLQASGLVFNTIFATLV
FT                   LGEAFTRYSFIGTILVCIGAVLIAVFGAIGEPAHSLDQLLELLQRRNFVLWMVGTAVVV
FT                   LVILLVSKSLKLLAFPHRSSRVRLIRGLCYGLISGILSAHSLLLAKSAVELLVRTIVDR
FT                   VNQFNRWQSWVILLAMISLALTQLYFLHRGLKLCSTSILYPFVFCIYNVIAILDGLIYF
FT                   RQLSQLAGFHAGLIALGTVVLLSGVLCLSWRLEIIESHACETVVGPSQTGLGPGIAFLE
FT                   EHPHSPREVGVEDEELHIGERQPLLQASHPPHGFPHRRAPSLPSVSSIPQQTPSADIDP
FT                   ASIWAELDDSDYEYTGTGPRWQPRPRSSTLRESVLRGPRHSTIGAVGQHAWTNRRHTRS
FT                   VYEGHHQRRTSILGPDNRQSLQKRSTYFSPLPGNHPSRSIGYGTSGESERERGHEGSTH
FT                   LISSSGGHEPLQLSATPSSDGPLAGSRNALAQAWRNGLQYLSRWSRHRPRTGSDSHDPL
FT                   LDSSHSPST"
     MGNLGDLSPQ GSVAVGVIVG LISTSLQAIG LTLQRKSHIL EDEKHPYDLR RPPYKRRRWQ        60
     LGMLMFVVSN IVGSTIQITT LPLPVLSTLQ ASGLVFNTIF ATLVLGEAFT RYSFIGTILV       120
     CIGAVLIAVF GAIGEPAHSL DQLLELLQRR NFVLWMVGTA VVVLVILLVS KSLKLLAFPH       180
     RSSRVRLIRG LCYGLISGIL SAHSLLLAKS AVELLVRTIV DRVNQFNRWQ SWVILLAMIS       240
     LALTQLYFLH RGLKLCSTSI LYPFVFCIYN VIAILDGLIY FRQLSQLAGF HAGLIALGTV       300
     VLLSGVLCLS WRLEIIESHA CETVVGPSQT GLGPGIAFLE EHPHSPREVG VEDEELHIGE       360
     RQPLLQASHP PHGFPHRRAP SLPSVSSIPQ QTPSADIDPA SIWAELDDSD YEYTGTGPRW       420
     QPRPRSSTLR ESVLRGPRHS TIGAVGQHAW TNRRHTRSVY EGHHQRRTSI LGPDNRQSLQ       480
     KRSTYFSPLP GNHPSRSIGY GTSGESERER GHEGSTHLIS SSGGHEPLQL SATPSSDGPL       540
     AGSRNALAQA WRNGLQYLSR WSRHRPRTGS DSHDPLLDSS HSPST                       585
//

If you have problems or comments...

PBIL Back to PBIL home page