(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE98

ASFUM1_6.PE98        Location/Qualifiers
FT   CDS             join(complement(358038..358283),complement(357720..357854),
FT                   complement(357383..357661))
FT                   /codon_start=1
FT                   /gene_family="HOG000202474" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20750823"
FT                   /orf_name="AFUA_6G02110"
FT                   /product="MADS box transcription factor Mcm1 "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85828.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG056359"
FT                   /db_xref="HOGENOM:HBG327033"
FT                   /db_xref="InterPro:IPR002100"
FT                   /db_xref="UniParc:UPI000051E82F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCR0"
FT                   /transl_table=1
FT                   /translation="MADITAVGEENPSPTQDDLQQAAGNGAADNRGPKRSRMSAEDDDD
FT                   DDDKPGRERRKIEIKFIQDKSRRHITFSKRKAGIMKKAYELSVLTGTQVLLLVVSETGL
FT                   VYTFTTPKLQPLVTKAEGKNLIQACLNAPDPATNENGVEAPEVPAETPEDVNHANVNPQ
FT                   QSNIPRPAGMHPGYMTNEQQQQMAYYQGLQQQQQAGGQYPGMPVGNRMPPQHQPTA"
     MADITAVGEE NPSPTQDDLQ QAAGNGAADN RGPKRSRMSA EDDDDDDDKP GRERRKIEIK        60
     FIQDKSRRHI TFSKRKAGIM KKAYELSVLT GTQVLLLVVS ETGLVYTFTT PKLQPLVTKA       120
     EGKNLIQACL NAPDPATNEN GVEAPEVPAE TPEDVNHANV NPQQSNIPRP AGMHPGYMTN       180
     EQQQQMAYYQ GLQQQQQAGG QYPGMPVGNR MPPQHQPTA                              219
//

If you have problems or comments...

PBIL Back to PBIL home page