(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE99

ASFUM1_6.PE99        Location/Qualifiers
FT   CDS             complement(360355..361968)
FT                   /codon_start=1
FT                   /gene_family="HOG000202452" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263237"
FT                   /orf_name="AFUA_6G02120"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85827.1"
FT                   /db_xref="HOGENOM:HBG056358"
FT                   /db_xref="HOGENOM:HBG327032"
FT                   /db_xref="InterPro:IPR006740"
FT                   /db_xref="UniParc:UPI000051FFDA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCR1"
FT                   /transl_table=1
FT                   /translation="MWKKSLDLHHSTKMPVFRLKTVFPLIALLSIIGFFWGIQRYDHAA
FT                   LRFKHPVDRVAPTTQTPQIQLQPSSPGSTKTCQADPYIMPPLPFTEWLPRKNYTRAYFR
FT                   PRFVSPRAEFSSLEDINVPVLPPMTVLERGMVVSPDNKDPSLPCPPIIDVDVAADDAVD
FT                   ETEKLLFGLATTADRLDRLLPSLLYSYGNTKAGIIVLVPESDDDLDKQMTYFRNRGLDL
FT                   TLIKSPLDFTARYFGLVQAFAEHIRTKRPQTTWVSFIDDDTFWLSLPTVAEELKLFDVN
FT                   KKHYIGALSEASWQVDTFGHIAFGGAGVFVSKPLLDVLEQYYDECQSWGEQPGDQKLGQ
FT                   CIQKYGDTPLTLWPSLYQMDMKGEVDGVYESGRKIESLHHWNSWYTKDVVKMTTVAAAA
FT                   GRKSVLRRWVFDQEEYVNNSTGKSVRTFWVMTNGYSLVKYTYDENTPDDAINFDHTEKT
FT                   WEEDPRGYEGRLGPLRLKDQAGVTKDRWLLREAYVVGDNVHQWYVREEDEGHSVIEIVW
FT                   LGPKGGGGAGVHDYAVRKQH"
     MWKKSLDLHH STKMPVFRLK TVFPLIALLS IIGFFWGIQR YDHAALRFKH PVDRVAPTTQ        60
     TPQIQLQPSS PGSTKTCQAD PYIMPPLPFT EWLPRKNYTR AYFRPRFVSP RAEFSSLEDI       120
     NVPVLPPMTV LERGMVVSPD NKDPSLPCPP IIDVDVAADD AVDETEKLLF GLATTADRLD       180
     RLLPSLLYSY GNTKAGIIVL VPESDDDLDK QMTYFRNRGL DLTLIKSPLD FTARYFGLVQ       240
     AFAEHIRTKR PQTTWVSFID DDTFWLSLPT VAEELKLFDV NKKHYIGALS EASWQVDTFG       300
     HIAFGGAGVF VSKPLLDVLE QYYDECQSWG EQPGDQKLGQ CIQKYGDTPL TLWPSLYQMD       360
     MKGEVDGVYE SGRKIESLHH WNSWYTKDVV KMTTVAAAAG RKSVLRRWVF DQEEYVNNST       420
     GKSVRTFWVM TNGYSLVKYT YDENTPDDAI NFDHTEKTWE EDPRGYEGRL GPLRLKDQAG       480
     VTKDRWLLRE AYVVGDNVHQ WYVREEDEGH SVIEIVWLGP KGGGGAGVHD YAVRKQH          537
//

If you have problems or comments...

PBIL Back to PBIL home page