(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE103

ASHGO_3.PE103        Location/Qualifiers
FT   CDS             160591..162684
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15747791"
FT                   /gene_name="ATP22"
FT                   /locus_tag="ACL103W"
FT                   /product="Mitochondrial translation factor ATP22 "
FT                   /biological_process="protein complex assembly"
FT                   /biological_process="regulation of translation "
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="AAS51125.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0006417"
FT                   /db_xref="GO:0006461"
FT                   /db_xref="HOGENOM:HBG058316"
FT                   /db_xref="InterPro:IPR017207"
FT                   /db_xref="UniParc:UPI0000252767"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75CM2"
FT                   /transl_table=1
FT                   /translation="MRRAGFQASSLLGRICSSGLNCKKLTVAFSSNEHMAMSSWAGDLG
FT                   RRIGTQLYRRENVAELRRLQAELQQQWTAAGDGRARAELEACARDEEERAFFRLLMPAS
FT                   GPEVTQRLEEAVKEVLGGRSSRAEKRERLYCAIALVARENAGRGIEVPEAAHRWFAADL
FT                   GRNEYFGHMQFLIEHGVQLNAPAAFQLVRTMLRSGSELEVQLVSFKLFLYDTESRRVFE
FT                   EKFDRVYDFMRMHYVITQMVVRRDFRFMRDYLEVLARRLEQHELCDARMSAAVQRDHIA
FT                   RYTELLMLYARKSGDEKMLAELFASLVDSLPRGMGGATLRQPLHEVMTYLISENQPQQV
FT                   LKLVAGMRKAEPNRRPGKSSVPGTLALVVSALRQFNNPNLVVSFIVQAYRKTQTRVLLG
FT                   QLGLWSLAFYGRAVALSPEAAKSPQELAQISPVDLPKELILKSVPDSCIMCELYQAILS
FT                   EKRSQVPAEEYREILIQLFALYQDFMGKLVHKYDYYHLYDTSVLRLLLYKIKNEVGDGE
FT                   LAFKLLMDFYGQPKMRPKCTAEGNPFGVVLYQNNAITQTQLNQALALMGGLRIPMDFKT
FT                   TSSMVLWYASAGDIDLAHTWYTKLVRGRFQMKNRRVLKLALAHGWTIPAYADQQLVSEL
FT                   SRADNSSDGPEHTQEAVETAVLESEEASACTSIIIEKADELLHKIQQTRPLDPPSDTRS
FT                   AAP"
     MRRAGFQASS LLGRICSSGL NCKKLTVAFS SNEHMAMSSW AGDLGRRIGT QLYRRENVAE        60
     LRRLQAELQQ QWTAAGDGRA RAELEACARD EEERAFFRLL MPASGPEVTQ RLEEAVKEVL       120
     GGRSSRAEKR ERLYCAIALV ARENAGRGIE VPEAAHRWFA ADLGRNEYFG HMQFLIEHGV       180
     QLNAPAAFQL VRTMLRSGSE LEVQLVSFKL FLYDTESRRV FEEKFDRVYD FMRMHYVITQ       240
     MVVRRDFRFM RDYLEVLARR LEQHELCDAR MSAAVQRDHI ARYTELLMLY ARKSGDEKML       300
     AELFASLVDS LPRGMGGATL RQPLHEVMTY LISENQPQQV LKLVAGMRKA EPNRRPGKSS       360
     VPGTLALVVS ALRQFNNPNL VVSFIVQAYR KTQTRVLLGQ LGLWSLAFYG RAVALSPEAA       420
     KSPQELAQIS PVDLPKELIL KSVPDSCIMC ELYQAILSEK RSQVPAEEYR EILIQLFALY       480
     QDFMGKLVHK YDYYHLYDTS VLRLLLYKIK NEVGDGELAF KLLMDFYGQP KMRPKCTAEG       540
     NPFGVVLYQN NAITQTQLNQ ALALMGGLRI PMDFKTTSSM VLWYASAGDI DLAHTWYTKL       600
     VRGRFQMKNR RVLKLALAHG WTIPAYADQQ LVSELSRADN SSDGPEHTQE AVETAVLESE       660
     EASACTSIII EKADELLHKI QQTRPLDPPS DTRSAAP                                697
//

If you have problems or comments...

PBIL Back to PBIL home page