(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE104

ASHGO_3.PE104        Location/Qualifiers
FT   CDS             162886..163956
FT                   /codon_start=1
FT                   /gene_family="HOG000243638" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15747792"
FT                   /locus_tag="AGOS_ACL102W"
FT                   /product="ACL102Wp"
FT                   /function="protein tyrosine/serine/threonine phosphatase
FT                   activity"
FT                   /biological_process="protein dephosphorylation "
FT                   /protein_id="AAS51126.2"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="GO:0008138"
FT                   /db_xref="HOGENOM:HBG058317"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016278"
FT                   /db_xref="InterPro:IPR020422"
FT                   /db_xref="UniParc:UPI0001DB275E"
FT                   /db_xref="UniProtKB/TrEMBL:Q75CM1"
FT                   /transl_table=1
FT                   /translation="MVEEVPDVTRILGGIYVGSVKPIVNHTPLKGMFNITHILSVLKFT
FT                   VIPEYLVRKGYTLKNIAIDDDESTDILQYINESNRFIDQCLFPHEEEYDPRKVDFRKKK
FT                   QHGSVYIHCQAGVSRSVSFTIAYLMYRYGLDLKSALHAVKRRRPEAQPNDGFMEQLRIF
FT                   EEMGGQYVDTALPRYRHWVLQASLQADPTGSGILAREETYRGDGEEDLQSLSTEDRHKL
FT                   TMLRCKKCRQRLALSTAFIQHEPPSAESSEGHFIRRAAGSRRIIDIQQSQDQCSHFFVE
FT                   PLNWMKAELQGKQELEGKFSCPNCTQKVGGYNWKGSRCSCGKWMIPAIHLQAAKVDQVD
FT                   AARLALPNLVNFETKQ"
     MVEEVPDVTR ILGGIYVGSV KPIVNHTPLK GMFNITHILS VLKFTVIPEY LVRKGYTLKN        60
     IAIDDDESTD ILQYINESNR FIDQCLFPHE EEYDPRKVDF RKKKQHGSVY IHCQAGVSRS       120
     VSFTIAYLMY RYGLDLKSAL HAVKRRRPEA QPNDGFMEQL RIFEEMGGQY VDTALPRYRH       180
     WVLQASLQAD PTGSGILARE ETYRGDGEED LQSLSTEDRH KLTMLRCKKC RQRLALSTAF       240
     IQHEPPSAES SEGHFIRRAA GSRRIIDIQQ SQDQCSHFFV EPLNWMKAEL QGKQELEGKF       300
     SCPNCTQKVG GYNWKGSRCS CGKWMIPAIH LQAAKVDQVD AARLALPNLV NFETKQ           356
//

If you have problems or comments...

PBIL Back to PBIL home page