(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE11

ASHGO_3.PE11         Location/Qualifiers
FT   CDS             complement(19203..19532)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931661"
FT                   /locus_tag="ACL195C"
FT                   /orf_name="AGOS_ACL195C"
FT                   /product="ACL195Cp"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS51033.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058320"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000025270B"
FT                   /db_xref="UniProtKB/TrEMBL:Q75CW1"
FT                   /transl_table=1
FT                   /translation="MADSGSDSHGDKRAAGYVHSTWKMKKPLRSCVRCRKNKIKCDSAT
FT                   RRPKPCSSCLKKGVGCELEYVIPPQRSKELRSLYENVAYVRLKLNELMESCDQLLDYCH
FT                   ASVDA"
     MADSGSDSHG DKRAAGYVHS TWKMKKPLRS CVRCRKNKIK CDSATRRPKP CSSCLKKGVG        60
     CELEYVIPPQ RSKELRSLYE NVAYVRLKLN ELMESCDQLL DYCHASVDA                   109
//

If you have problems or comments...

PBIL Back to PBIL home page