(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE110

ASHGO_3.PE110        Location/Qualifiers
FT   CDS             169501..172005
FT                   /codon_start=1
FT                   /gene_family="HOG000248496" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15747796"
FT                   /locus_tag="AGOS_ACL096W"
FT                   /product="ACL096Wp"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS51132.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058321"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001DB2763"
FT                   /db_xref="UniProtKB/TrEMBL:Q75CL5"
FT                   /transl_table=1
FT                   /translation="MAADGQTGPMESYQAVVQSGEVQELEYGQAAGYPEVMEVCGTLAG
FT                   REERNKRPAKRAPLACLRCRRRHVRCPGGTPCAKCAVANIACEYLEPSKKLIVSMKYLQ
FT                   RLQEDLARARKENAALNAALREERGEVEMQARTLAAEAEEGIQFHRNTVDEEDEVVPDF
FT                   AERRGRLVESRKGQRYFVGSSSMTLFGMEVQSLVPEALQRDRGELESPILGAARLAAPS
FT                   AVDQQAERVTLVHQDDNSTYKLVLNGSYGGTEELELHLRLPPFAYAMLLVDTFVTYNDG
FT                   CFYFFNEGIVKHSLRRSYAGHVAYQDYTLQAMWLCKVFLIFAIGEMYLGTANCDLNEHP
FT                   SSRRRSTLPGSGFFAHAAQLFSILFSSEGIENATAEGGIEIMLLYAFYLQVADRTVPSY
FT                   FYFGEALRACLILGWHVDAQRDVLTRFELEHHRRLWWTVYMFERMLSSKAGLPLSLSDN
FT                   TIATELPDDFDMSNPPPGCEHYIFAEAEYITHCVRITQVNAQILIKLYQKQPDSNILPI
FT                   IKDIVMQLLEWRANMSAFLQVDFTQKELKISRLCTNMFTEYFQGLNLAIRPLLFHFVSK
FT                   QLASFQETNTYINLSKYSKTISSLLNCSLQASINSIRSLWVLMGENMVALFGYMDREYL
FT                   FTSACTLIFFNAAFGIHEQTYHHLDHALRIFTKMRDLGNHPAGLRMAQLLRLMIDLDFH
FT                   DVMKDLIAKHSDSSRCASSSFDQPQAEIDTLMQPRPQSPTASTTSSSALSTDSVAPDMT
FT                   ELSKHETLTIEKNVSRLDLQTLDMHEDLQELLDNLDEVGKSDDQLWKEVTDQAMWLGSS
FT                   MDPTSALGNEADFYRSNSTQFK"
     MAADGQTGPM ESYQAVVQSG EVQELEYGQA AGYPEVMEVC GTLAGREERN KRPAKRAPLA        60
     CLRCRRRHVR CPGGTPCAKC AVANIACEYL EPSKKLIVSM KYLQRLQEDL ARARKENAAL       120
     NAALREERGE VEMQARTLAA EAEEGIQFHR NTVDEEDEVV PDFAERRGRL VESRKGQRYF       180
     VGSSSMTLFG MEVQSLVPEA LQRDRGELES PILGAARLAA PSAVDQQAER VTLVHQDDNS       240
     TYKLVLNGSY GGTEELELHL RLPPFAYAML LVDTFVTYND GCFYFFNEGI VKHSLRRSYA       300
     GHVAYQDYTL QAMWLCKVFL IFAIGEMYLG TANCDLNEHP SSRRRSTLPG SGFFAHAAQL       360
     FSILFSSEGI ENATAEGGIE IMLLYAFYLQ VADRTVPSYF YFGEALRACL ILGWHVDAQR       420
     DVLTRFELEH HRRLWWTVYM FERMLSSKAG LPLSLSDNTI ATELPDDFDM SNPPPGCEHY       480
     IFAEAEYITH CVRITQVNAQ ILIKLYQKQP DSNILPIIKD IVMQLLEWRA NMSAFLQVDF       540
     TQKELKISRL CTNMFTEYFQ GLNLAIRPLL FHFVSKQLAS FQETNTYINL SKYSKTISSL       600
     LNCSLQASIN SIRSLWVLMG ENMVALFGYM DREYLFTSAC TLIFFNAAFG IHEQTYHHLD       660
     HALRIFTKMR DLGNHPAGLR MAQLLRLMID LDFHDVMKDL IAKHSDSSRC ASSSFDQPQA       720
     EIDTLMQPRP QSPTASTTSS SALSTDSVAP DMTELSKHET LTIEKNVSRL DLQTLDMHED       780
     LQELLDNLDE VGKSDDQLWK EVTDQAMWLG SSMDPTSALG NEADFYRSNS TQFK             834
//

If you have problems or comments...

PBIL Back to PBIL home page