(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE113

ASHGO_3.PE113        Location/Qualifiers
FT   CDS             complement(178229..181261)
FT                   /codon_start=1
FT                   /gene_family="HOG000094358" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20621898"
FT                   /locus_tag="AGOS_ACL093C"
FT                   /product="ACL093Cp"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS51135.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058323"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001DB2764"
FT                   /db_xref="UniProtKB/TrEMBL:Q75CL2"
FT                   /transl_table=1
FT                   /translation="MRQPDGSVQQWDGAEGGDTPTMHTNNSMLSFNDDYTSLLNNLTNA
FT                   GVAAERATQPSERNAHRGGDGRQSLDQLLQQYHAVEEKVGNGGSEGRLQFASGEQPDTR
FT                   KAAAGGDGAVPGNQCDHCRRRQVKCVTVAEHSNCLQCETKGIKCVFSEMPSARMKKTLQ
FT                   QGMQNKRSRSEENGAWIQELLKRTKGSVPSSSESISQFYADLLQNLNSTLANTPPPPIF
FT                   SKKNHEAGIPIHSASSPSGPGHYSYASNPPTADAVGRNDSHLNSALAKYPRSSFYVGPT
FT                   SMFDVNLVNHMKLDKIDQVQLSNTLALRKVAPGVQFVLRADFNHQLYLKNERDVDLVEK
FT                   LVHPHGKILVDIFFKLIHPYFPILHERVFLEKYSKSYRELTAPILASIYSLALQWWDFH
FT                   PQAVGFQRPDVIDQLNEIALRTFFDVLERPKLSIVQTGLLILQCRSECPNNWILCSEVV
FT                   ALAEDLGLGIDCKDWRLPSWERGLRRRLAWAVWYQDKWISMLEARYSHLILGRNWLVKM
FT                   LSDQDFPANSPVISNSQEKSNANIGTGKTAPSNISVLDLSPTDEDFNNGKLLFRQMVSL
FT                   SIILGEILDTFYTLGAISTTTKIEQVLKLAKPLQLKLREWYHSLPSKLSMNNFQPRKFN
FT                   SNASLTLAYFAAEITLHRKIITTLQPDSPGDLVQVCRTAAKTRLIAAIEFVRDLKTEHI
FT                   SAFWYSCTTGNLTLISTFAGLLYVTAPTKEDAQVFRDCLRNYVWILRMASKSYEKAANA
FT                   LDRIQMLLSQIPGLLTDEVAPQQFAPPRSQSPYSQQYSTAGSHSGFEAQSGQNTAGMLD
FT                   GDPNLSTGTFQQLRSLPQDVLLTLKSIQHNLPGVPHDIRGHRPTAAKSDDELELSPGYT
FT                   GASAQVQGTGPYKGGQQEHTNSKPSATSSSSATMPSATNGKSGSESSASFGGDTDSSGK
FT                   RNSSNSNAGAAFKPNSALESGQDTQVGSTSPTPSSSVDNPQSKRVEDNTSLVKSPRNSP
FT                   NMPGSTGGSSSVESASVEHSE"
     MRQPDGSVQQ WDGAEGGDTP TMHTNNSMLS FNDDYTSLLN NLTNAGVAAE RATQPSERNA        60
     HRGGDGRQSL DQLLQQYHAV EEKVGNGGSE GRLQFASGEQ PDTRKAAAGG DGAVPGNQCD       120
     HCRRRQVKCV TVAEHSNCLQ CETKGIKCVF SEMPSARMKK TLQQGMQNKR SRSEENGAWI       180
     QELLKRTKGS VPSSSESISQ FYADLLQNLN STLANTPPPP IFSKKNHEAG IPIHSASSPS       240
     GPGHYSYASN PPTADAVGRN DSHLNSALAK YPRSSFYVGP TSMFDVNLVN HMKLDKIDQV       300
     QLSNTLALRK VAPGVQFVLR ADFNHQLYLK NERDVDLVEK LVHPHGKILV DIFFKLIHPY       360
     FPILHERVFL EKYSKSYREL TAPILASIYS LALQWWDFHP QAVGFQRPDV IDQLNEIALR       420
     TFFDVLERPK LSIVQTGLLI LQCRSECPNN WILCSEVVAL AEDLGLGIDC KDWRLPSWER       480
     GLRRRLAWAV WYQDKWISML EARYSHLILG RNWLVKMLSD QDFPANSPVI SNSQEKSNAN       540
     IGTGKTAPSN ISVLDLSPTD EDFNNGKLLF RQMVSLSIIL GEILDTFYTL GAISTTTKIE       600
     QVLKLAKPLQ LKLREWYHSL PSKLSMNNFQ PRKFNSNASL TLAYFAAEIT LHRKIITTLQ       660
     PDSPGDLVQV CRTAAKTRLI AAIEFVRDLK TEHISAFWYS CTTGNLTLIS TFAGLLYVTA       720
     PTKEDAQVFR DCLRNYVWIL RMASKSYEKA ANALDRIQML LSQIPGLLTD EVAPQQFAPP       780
     RSQSPYSQQY STAGSHSGFE AQSGQNTAGM LDGDPNLSTG TFQQLRSLPQ DVLLTLKSIQ       840
     HNLPGVPHDI RGHRPTAAKS DDELELSPGY TGASAQVQGT GPYKGGQQEH TNSKPSATSS       900
     SSATMPSATN GKSGSESSAS FGGDTDSSGK RNSSNSNAGA AFKPNSALES GQDTQVGSTS       960
     PTPSSSVDNP QSKRVEDNTS LVKSPRNSPN MPGSTGGSSS VESASVEHSE                 1010
//

If you have problems or comments...

PBIL Back to PBIL home page