(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE122

ASHGO_3.PE122        Location/Qualifiers
FT   CDS             complement(199009..199632)
FT                   /codon_start=1
FT                   /gene_family="HOG000233968" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15747799"
FT                   /locus_tag="ACL084C"
FT                   /orf_name="AGOS_ACL084C"
FT                   /product="ACL084Cp"
FT                   /function="GTP binding"
FT                   /biological_process="protein transport"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /protein_id="AAS51144.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG527536"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="HSSP:1KAO"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003579"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR015599"
FT                   /db_xref="InterPro:IPR020851"
FT                   /db_xref="UniParc:UPI000025277A"
FT                   /db_xref="UniProtKB/TrEMBL:Q75CK3"
FT                   /transl_table=1
FT                   /translation="MNSNVTSIKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFL
FT                   TQRVNMDSKTIKFEIWDTAGQERFASLAPMYYRNAQAALVVYDITKPQSFIKARHWVKE
FT                   LHEQASKGIVIALVGNKLDLLENGEARKVSREEAEKLAEEEGLLFFETSAKTGDKINEV
FT                   FLAIGEKIPLAKVGEQPASGPSVDNARLDLNAVSSNQHANSCNC"
     MNSNVTSIKL VLLGEAAVGK SSIVLRFVSN DFSENKEPTI GAAFLTQRVN MDSKTIKFEI        60
     WDTAGQERFA SLAPMYYRNA QAALVVYDIT KPQSFIKARH WVKELHEQAS KGIVIALVGN       120
     KLDLLENGEA RKVSREEAEK LAEEEGLLFF ETSAKTGDKI NEVFLAIGEK IPLAKVGEQP       180
     ASGPSVDNAR LDLNAVSSNQ HANSCNC                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page