(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE123

ASHGO_3.PE123        Location/Qualifiers
FT   CDS             complement(199834..201459)
FT                   /codon_start=1
FT                   /gene_family="HOG000209682" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15747800"
FT                   /locus_tag="ACL083C"
FT                   /orf_name="AGOS_ACL083C"
FT                   /product="ACL083Cp"
FT                   /function="metal ion binding"
FT                   /function="protein serine/threonine phosphatase activity "
FT                   /biological_process="protein dephosphorylation "
FT                   /cellular_component="protein serine/threonine phosphatase
FT                   complex"
FT                   /protein_id="AAS51145.1"
FT                   /db_xref="GO:0004722"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="GO:0008287"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG058329"
FT                   /db_xref="HOGENOM:HBG676973"
FT                   /db_xref="InterPro:IPR000222"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014045"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="UniParc:UPI000025277B"
FT                   /db_xref="UniProtKB/TrEMBL:Q75CK2"
FT                   /transl_table=1
FT                   /translation="MAIPTPFSPWGKAARTLSRCLSKRNFSKLVIARRLNSTHHRGKPM
FT                   RLERELRYAIIGGTLLLTYSYMSSCLSSDTIKGIKQYGAPARSLSTSSDGKANGNPDTI
FT                   SLLTDYEVNTKLRSLEESYYVNRGKGVLRYDVSQLPSNNPIEDSRVEQIITVPNEQTQA
FT                   QEELYFFGIFDGHGGPYTSSKLSEALVPYVAHQLSKIYAQGNEALTSEAIDDAIEQGFL
FT                   QLDNDIVQKTLGQFFENPSKESLIEALPAVSGACSLLAMYDSNNCTLKVALTGDSRALL
FT                   GRVDENGKWTVQSLTIDQTGDNADEVARIRAEHPGEPNCVRNGRVLGSLQPSRAFGDYR
FT                   YKVKEINGKNVYDLPSHLKIFFRKEPREFLTPPYVTAQPEITTAQIDSSARFMVIASDG
FT                   LFELLTNEEIAGLVVKWMEKHPVKKGFETLKSSARDKIPPVHDTTVHAESQRPAFRYKD
FT                   ANKGSAGFLMEDNNVATHLIRNALSGGGDKRYVSTLISIPSPKSRSYRDDLTVTVVFFG
FT                   EEQNQPDNQLILNHEATRPLEPKL"
     MAIPTPFSPW GKAARTLSRC LSKRNFSKLV IARRLNSTHH RGKPMRLERE LRYAIIGGTL        60
     LLTYSYMSSC LSSDTIKGIK QYGAPARSLS TSSDGKANGN PDTISLLTDY EVNTKLRSLE       120
     ESYYVNRGKG VLRYDVSQLP SNNPIEDSRV EQIITVPNEQ TQAQEELYFF GIFDGHGGPY       180
     TSSKLSEALV PYVAHQLSKI YAQGNEALTS EAIDDAIEQG FLQLDNDIVQ KTLGQFFENP       240
     SKESLIEALP AVSGACSLLA MYDSNNCTLK VALTGDSRAL LGRVDENGKW TVQSLTIDQT       300
     GDNADEVARI RAEHPGEPNC VRNGRVLGSL QPSRAFGDYR YKVKEINGKN VYDLPSHLKI       360
     FFRKEPREFL TPPYVTAQPE ITTAQIDSSA RFMVIASDGL FELLTNEEIA GLVVKWMEKH       420
     PVKKGFETLK SSARDKIPPV HDTTVHAESQ RPAFRYKDAN KGSAGFLMED NNVATHLIRN       480
     ALSGGGDKRY VSTLISIPSP KSRSYRDDLT VTVVFFGEEQ NQPDNQLILN HEATRPLEPK       540
     L                                                                       541
//

If you have problems or comments...

PBIL Back to PBIL home page