(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE130

ASHGO_3.PE130        Location/Qualifiers
FT   CDS             join(214736..214879,215024..215452)
FT                   /codon_start=1
FT                   /gene_family="HOG000197237" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15747805"
FT                   /locus_tag="ACL076W"
FT                   /orf_name="AGOS_ACL076W"
FT                   /product="ACL076Wp"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="rRNA processing"
FT                   /biological_process="ribosomal small subunit biogenesis "
FT                   /biological_process="translation"
FT                   /cellular_component="90S preribosome"
FT                   /cellular_component="cytosolic small ribosomal subunit "
FT                   /cellular_component="small-subunit processome"
FT                   /protein_id="AAS51152.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0022627"
FT                   /db_xref="GO:0030686"
FT                   /db_xref="GO:0032040"
FT                   /db_xref="GO:0042274"
FT                   /db_xref="HOGENOM:HBG320156"
FT                   /db_xref="HOGENOM:HBG329875"
FT                   /db_xref="InterPro:IPR000554"
FT                   /db_xref="UniParc:UPI0000252782"
FT                   /db_xref="UniProtKB/TrEMBL:Q75CJ5"
FT                   /transl_table=1
FT                   /translation="MSAPQAKILSQAPTELELQVAQAFIDLENSSPELKADLRPLQFKS
FT                   IREIDVAGGKKALAIFVPVPSLAGYHKVQTKLTRELEKKFQDRHVIFLAERRILPKPSR
FT                   RSRQTQKRPRSRTLTAVHDKILEDLVFPTEIVGKRVRYLVGGNKIQKVLLDSKDVQQVD
FT                   YKLESFQAVYNKLTGKQIVFEIPSETH"
     MSAPQAKILS QAPTELELQV AQAFIDLENS SPELKADLRP LQFKSIREID VAGGKKALAI        60
     FVPVPSLAGY HKVQTKLTRE LEKKFQDRHV IFLAERRILP KPSRRSRQTQ KRPRSRTLTA       120
     VHDKILEDLV FPTEIVGKRV RYLVGGNKIQ KVLLDSKDVQ QVDYKLESFQ AVYNKLTGKQ       180
     IVFEIPSETH                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page