(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE134

ASHGO_3.PE134        Location/Qualifiers
FT   CDS             222769..224418
FT                   /codon_start=1
FT                   /gene_family="HOG000187297" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19774443"
FT                   /locus_tag="AGOS_ACL073W"
FT                   /product="ACL073Wp"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS51155.2"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG177066"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniParc:UPI0001DB2786"
FT                   /db_xref="UniProtKB/TrEMBL:Q75CJ2"
FT                   /transl_table=1
FT                   /translation="MATDIKAPLLVHTEDLEGSGTSSDSARSYYGGVKIAEDVISPVLA
FT                   NEVPQGRHLGLFSTVVMFVSRIVGSGIFATPSTMFVNCGGNALLFVTVWIVAMLAAFSG
FT                   LYLYLEFGCLLPRSGGPKNFLEAVYDRPRMMMSVAFASFSVLTGFTVSGAIVFGKYTLY
FT                   ALGFDRKYVNEDSAMCNYIGAAAVMLIVVIHGSSVKHGIIVQNILGGMKFLLIAVMSVT
FT                   GIYAVFFFDTRADDQNPAYYVKSHFWESRDSSLITASSLTASFMQAFFCFSGWDGVHSV
FT                   VSEVKDPVRTMRIAGPFSLLIAFGCYMLLNFAYLFVLSWEEIQGAGPLIGSILFSKLYG
FT                   PTLGGKFVTLCVAVSTASNLFVVIYGTSRMNQEFFREGYLPFSKQMASNWPWGSPLPSL
FT                   LCCGLITVAWLCFLPPSGAAYDYLVNFEGYSKQFFLMLIAIGLFIYRHRHPDIVAEIRA
FT                   SMIGVAFLAVISVYLMVGPFFGDQSGNVVGWLPPYQITTLLMFLVCFLYWLLKFVLLPR
FT                   LLGYRLQALIVTLSDGLEIKRWRRRYSKQASI"
     MATDIKAPLL VHTEDLEGSG TSSDSARSYY GGVKIAEDVI SPVLANEVPQ GRHLGLFSTV        60
     VMFVSRIVGS GIFATPSTMF VNCGGNALLF VTVWIVAMLA AFSGLYLYLE FGCLLPRSGG       120
     PKNFLEAVYD RPRMMMSVAF ASFSVLTGFT VSGAIVFGKY TLYALGFDRK YVNEDSAMCN       180
     YIGAAAVMLI VVIHGSSVKH GIIVQNILGG MKFLLIAVMS VTGIYAVFFF DTRADDQNPA       240
     YYVKSHFWES RDSSLITASS LTASFMQAFF CFSGWDGVHS VVSEVKDPVR TMRIAGPFSL       300
     LIAFGCYMLL NFAYLFVLSW EEIQGAGPLI GSILFSKLYG PTLGGKFVTL CVAVSTASNL       360
     FVVIYGTSRM NQEFFREGYL PFSKQMASNW PWGSPLPSLL CCGLITVAWL CFLPPSGAAY       420
     DYLVNFEGYS KQFFLMLIAI GLFIYRHRHP DIVAEIRASM IGVAFLAVIS VYLMVGPFFG       480
     DQSGNVVGWL PPYQITTLLM FLVCFLYWLL KFVLLPRLLG YRLQALIVTL SDGLEIKRWR       540
     RRYSKQASI                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page