(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE138

ASHGO_3.PE138        Location/Qualifiers
FT   CDS             complement(232439..234373)
FT                   /codon_start=1
FT                   /gene_family="HOG000222134" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15747809"
FT                   /locus_tag="AGOS_ACL069C"
FT                   /product="ACL069Cp"
FT                   /function="glycerol kinase activity"
FT                   /biological_process="glycerol-3-phosphate metabolic process"
FT                   /protein_id="AAS51159.2"
FT                   /db_xref="GO:0004370"
FT                   /db_xref="GO:0006072"
FT                   /db_xref="HOGENOM:HBG252634"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniParc:UPI0001DB2788"
FT                   /db_xref="UniProtKB/TrEMBL:Q75CI8"
FT                   /transl_table=1
FT                   /translation="MTLNVVPKGEIPLIAAIDVGTTSTRAILFNKQGQEVSKYQIEYST
FT                   TAAKDKEASSPGSAGSGKGIIFSAEGIAIEANEYVEIEELEHQDATLRFPHPGWVECKP
FT                   MNILANVVQCFAATLISINKVNDERVENNLPPYVIKCIGVTNMRETTIVWSKKTGLPVV
FT                   DYGIVWNDTRTMDIVNTKKSETPPEEQERLRAKTGLPPYSTYFSCSKLRWFLDNVPEVL
FT                   EAYESGDLMFGTVDTWLIYHLTGNHAFVSDVTNASRTGFMNLDTLDYDDELLEYWGIDR
FT                   SKLNMPKIVPSAQYYGDFCVPAVTKKKLTEAAWDVLTSFSQSGIPIQGCLGDQSSSLVG
FT                   QMAFKAGSAKCTYGTGCFLLYNTGTKKLLSQHGALTTFGFWFPELEGSEASKPHFVLEG
FT                   SVAVAGSVVQWLRDNLRLFPRAEDVGPLASRVPDCGGVVFVPAFSGLFAPYWDAAARGT
FT                   ILGMSQFTTASHIARAAIEGVCFQARAILKAMSSDAFGEGAKDHDFLEEIVDTGTYEHS
FT                   PLSVLAVDGGMSKSDEVMQIQADILGPCVKVRRSPTAESTALGAAIAACMAYKDPNERV
FT                   WKDLNDAKKWIFYGGLEKEEALRTPDNVSSKLKIFASQSVDTVRRKNWKRWEAAIERTK
FT                   GWLHDAEGN"
     MTLNVVPKGE IPLIAAIDVG TTSTRAILFN KQGQEVSKYQ IEYSTTAAKD KEASSPGSAG        60
     SGKGIIFSAE GIAIEANEYV EIEELEHQDA TLRFPHPGWV ECKPMNILAN VVQCFAATLI       120
     SINKVNDERV ENNLPPYVIK CIGVTNMRET TIVWSKKTGL PVVDYGIVWN DTRTMDIVNT       180
     KKSETPPEEQ ERLRAKTGLP PYSTYFSCSK LRWFLDNVPE VLEAYESGDL MFGTVDTWLI       240
     YHLTGNHAFV SDVTNASRTG FMNLDTLDYD DELLEYWGID RSKLNMPKIV PSAQYYGDFC       300
     VPAVTKKKLT EAAWDVLTSF SQSGIPIQGC LGDQSSSLVG QMAFKAGSAK CTYGTGCFLL       360
     YNTGTKKLLS QHGALTTFGF WFPELEGSEA SKPHFVLEGS VAVAGSVVQW LRDNLRLFPR       420
     AEDVGPLASR VPDCGGVVFV PAFSGLFAPY WDAAARGTIL GMSQFTTASH IARAAIEGVC       480
     FQARAILKAM SSDAFGEGAK DHDFLEEIVD TGTYEHSPLS VLAVDGGMSK SDEVMQIQAD       540
     ILGPCVKVRR SPTAESTALG AAIAACMAYK DPNERVWKDL NDAKKWIFYG GLEKEEALRT       600
     PDNVSSKLKI FASQSVDTVR RKNWKRWEAA IERTKGWLHD AEGN                        644
//

If you have problems or comments...

PBIL Back to PBIL home page