(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE149

ASHGO_3.PE149        Location/Qualifiers
FT   CDS             261725..264178
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15747816"
FT                   /locus_tag="AGOS_ACL058W"
FT                   /product="ACL058Wp"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS51170.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058341"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001DB27A7"
FT                   /db_xref="UniProtKB/TrEMBL:Q75CH7"
FT                   /transl_table=1
FT                   /translation="MADKGLKVITIKDQSAVVLEDGTVYKVQHKRQRRVLNCMPCHKRK
FT                   VKCNRARPVCDHCEKNRYACAYFVNDRVSRGGQNKVPRESKLRLMRVIEQARRAVEQGA
FT                   ADEAGGGAAAGAGGAAEVVGGAAEGAALEQALEQALEQALEQALEQALERERHAELLEY
FT                   YRVAVAPVLPLVDMEGYTRDAEAFWATWDGELDSERLDFLLLHMPLMYVSLKAQYHETN
FT                   GAQLVEEVCMYHGLIRQLYALYDFPNKFTMRSLTGNVLLNSAVENPNISSVAQLARLAQ
FT                   RLQLTADPEYVPGSREMADVQFRRIIFWQIFQLDTLTSLQNRLPPLLRYNECETSLPSE
FT                   FDEGGKLNPNLCFLNAKYQFVILVNDVCRMDAALSRSVLSDKDLLEFRERVAQLHALCA
FT                   NKASLLTDYSRRCAIQAPVASFTCWAIFMLNTFADRAVLLHQDMLLRTMAKWKKQKDLE
FT                   SQLEQVPSSKFSDEFRIFHSIITDGGTSIAAYMKNISTSNACNTMSMLFPATLHCLQEF
FT                   VNYYKGKHISSFNWLLLIGTLPMAAVTFALRTLMVDLIHARDSSGTISLKTDLRFKLLY
FT                   QVVTMIESRLQTSAAVYKSSLTLARLFLRLVLLKFGTPDDMERIQLNPSVTNNISSQLP
FT                   SPLPFSQQTAWPANVLKLTQNHSMPHTTALTVEQPLYGFSHNPRATQGQQEHFRSLQRH
FT                   GTSELSVCNTDPQRALQGMPCTPLPTVQHTPPISGYSLDNNSDQRSIWHDFPTPLSADD
FT                   ALSQAESMDHATELSHIRSEVERYVRLISASGKARDGESVSLDGTYFQEFECTLLEVIQ
FT                   TTLSM"
     MADKGLKVIT IKDQSAVVLE DGTVYKVQHK RQRRVLNCMP CHKRKVKCNR ARPVCDHCEK        60
     NRYACAYFVN DRVSRGGQNK VPRESKLRLM RVIEQARRAV EQGAADEAGG GAAAGAGGAA       120
     EVVGGAAEGA ALEQALEQAL EQALEQALEQ ALERERHAEL LEYYRVAVAP VLPLVDMEGY       180
     TRDAEAFWAT WDGELDSERL DFLLLHMPLM YVSLKAQYHE TNGAQLVEEV CMYHGLIRQL       240
     YALYDFPNKF TMRSLTGNVL LNSAVENPNI SSVAQLARLA QRLQLTADPE YVPGSREMAD       300
     VQFRRIIFWQ IFQLDTLTSL QNRLPPLLRY NECETSLPSE FDEGGKLNPN LCFLNAKYQF       360
     VILVNDVCRM DAALSRSVLS DKDLLEFRER VAQLHALCAN KASLLTDYSR RCAIQAPVAS       420
     FTCWAIFMLN TFADRAVLLH QDMLLRTMAK WKKQKDLESQ LEQVPSSKFS DEFRIFHSII       480
     TDGGTSIAAY MKNISTSNAC NTMSMLFPAT LHCLQEFVNY YKGKHISSFN WLLLIGTLPM       540
     AAVTFALRTL MVDLIHARDS SGTISLKTDL RFKLLYQVVT MIESRLQTSA AVYKSSLTLA       600
     RLFLRLVLLK FGTPDDMERI QLNPSVTNNI SSQLPSPLPF SQQTAWPANV LKLTQNHSMP       660
     HTTALTVEQP LYGFSHNPRA TQGQQEHFRS LQRHGTSELS VCNTDPQRAL QGMPCTPLPT       720
     VQHTPPISGY SLDNNSDQRS IWHDFPTPLS ADDALSQAES MDHATELSHI RSEVERYVRL       780
     ISASGKARDG ESVSLDGTYF QEFECTLLEV IQTTLSM                                817
//

If you have problems or comments...

PBIL Back to PBIL home page