(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE15

ASHGO_3.PE15         Location/Qualifiers
FT   CDS             complement(26476..27573)
FT                   /codon_start=1
FT                   /gene_family="HOG000233024" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20626158"
FT                   /locus_tag="ACL191C"
FT                   /orf_name="AGOS_ACL191C"
FT                   /product="ACL191Cp"
FT                   /function="ATP binding"
FT                   /function="MAP kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS51037.1"
FT                   /db_xref="GO:0004707"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="HSSP:1A9U"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR003527"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000025270F"
FT                   /db_xref="UniProtKB/TrEMBL:Q75CV7"
FT                   /transl_table=1
FT                   /translation="MPRTITFDIPSHYKLVDLIGEGAYGIVCSAIHKPTGTKVAIKKIQ
FT                   PFTRPMFVTRTLRELKLLKFFHSHENIISVLDIVRPTSYQDFEAVYLVQELMETDLQRI
FT                   ISQPNSFLSDDHIQYFTYQILRALKSLHSAQVIHRDLKPSNLLLNSSCDLKLCDFGLSR
FT                   CLASSDRSRENMVGFMTEYVATRWYRAPEIMLSFQEYTTAMDIWSCGCILAEMISGKPL
FT                   FPGRDYHHQLWIILEILGTPSFEDFEQIKSKRAKAYIANLPMRPKIPWNVALSTNDINP
FT                   LAMDLLDKMLTFNPDKRISAADALKHPYLETYHDAEDEPDYELLNLQDNFWKVDNEARQ
FT                   KTEEEELSMDTLKAMLYEEVMKPLQ"
     MPRTITFDIP SHYKLVDLIG EGAYGIVCSA IHKPTGTKVA IKKIQPFTRP MFVTRTLREL        60
     KLLKFFHSHE NIISVLDIVR PTSYQDFEAV YLVQELMETD LQRIISQPNS FLSDDHIQYF       120
     TYQILRALKS LHSAQVIHRD LKPSNLLLNS SCDLKLCDFG LSRCLASSDR SRENMVGFMT       180
     EYVATRWYRA PEIMLSFQEY TTAMDIWSCG CILAEMISGK PLFPGRDYHH QLWIILEILG       240
     TPSFEDFEQI KSKRAKAYIA NLPMRPKIPW NVALSTNDIN PLAMDLLDKM LTFNPDKRIS       300
     AADALKHPYL ETYHDAEDEP DYELLNLQDN FWKVDNEARQ KTEEEELSMD TLKAMLYEEV       360
     MKPLQ                                                                   365
//

If you have problems or comments...

PBIL Back to PBIL home page