(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE153

ASHGO_3.PE153        Location/Qualifiers
FT   CDS             269705..272623
FT                   /codon_start=1
FT                   /gene_family="HOG000246715" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15747819"
FT                   /gene_name="ATG1"
FT                   /locus_tag="ACL054W"
FT                   /product="Serine/threonine-protein kinase ATG1 "
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="autophagy"
FT                   /biological_process="protein phosphorylation"
FT                   /biological_process="protein transport"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS51174.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG058343"
FT                   /db_xref="HOGENOM:HBG324852"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020656"
FT                   /db_xref="InterPro:IPR022708"
FT                   /db_xref="UniParc:UPI0000252798"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75CH3"
FT                   /transl_table=1
FT                   /translation="MNNVKSGGRPVAIVAERYVVEKEIGRGSFAVVYKGHLADSSAGNV
FT                   AIKAVSRSKLRNKKLLENLEIEIAILKKIKHPHIVGLLECERTGTDFYLMMEYCALGDL
FT                   TFFIKKRRSLMDKHPLVRTLFEKYPPPSEHHNGLNRVLVVNYLQQLSSALKFLRSKNLV
FT                   HRDIKPQNLLLSTPLVDYNDPAEFHARGFVGIYNLPILKIADFGFARFLPNTSLAETLC
FT                   GSPLYMAPEILNYQKYNAKADLWSVGTVLYEMCCGKPPFKASNHLELFQKIKKANDVIQ
FT                   FPKHAALESAMVDLICGLLTFEPAKRMGFTEFFSNGLVNEDLSPYEVESEPDLETKSKN
FT                   VAESNMFISEYLPTAERNKRASPIRLGDSCTLRGPCESPQGADPYPQDNTQSDQHEHLH
FT                   ADYSFQVEMGQDGQQADGEEKRKLYNNQEERSNEERQFGQVSNGRNQEDQLLLHQGRGQ
FT                   IPCEQNRQALQSHSHVAAKQIPDKDSKSSVSCQKHAASAPTKNDHRTTRLKEKTKCSYS
FT                   DLLLEKEYVVVEKKSVEVNALADEFAQAGSGAPAIRLPDQHHNDASQALQMARHSSTSV
FT                   SAANTAKQTLLRRNSRTLSSSGASTSRRPSLVDRRLSITSLGATNALSKALGMASLRLF
FT                   GNSHQQSSNGSSTFKQNPNVTSLLSPQTFQDMTENAVLSADHQWDNSRQADVLHDDSIM
FT                   KALENLTAKVYAIYSFAEVKFSQIIPLPPSSTQDPYTHKRMSNGSCAIDDEEDDIEHSP
FT                   GAETYRKNSSGANANTGNYNFSLDTIHEMNLNDLPPNDLYILCTEAIVLYMKSLSLLAY
FT                   AMHLTSKWWHESADKICPLKLNLLVQWIRERFNECLEKAEFLRMKTQSIQLHNGNQLSA
FT                   STMVSEPVFVEKLIYDRALDISKTAAKMEMQGEYLEGCEVAYSTSLWMLEALLDDVSDE
FT                   DNYNDDNLGHTGVLDKSDKEVIKRYIDSIANRLKALRRKLSR"
     MNNVKSGGRP VAIVAERYVV EKEIGRGSFA VVYKGHLADS SAGNVAIKAV SRSKLRNKKL        60
     LENLEIEIAI LKKIKHPHIV GLLECERTGT DFYLMMEYCA LGDLTFFIKK RRSLMDKHPL       120
     VRTLFEKYPP PSEHHNGLNR VLVVNYLQQL SSALKFLRSK NLVHRDIKPQ NLLLSTPLVD       180
     YNDPAEFHAR GFVGIYNLPI LKIADFGFAR FLPNTSLAET LCGSPLYMAP EILNYQKYNA       240
     KADLWSVGTV LYEMCCGKPP FKASNHLELF QKIKKANDVI QFPKHAALES AMVDLICGLL       300
     TFEPAKRMGF TEFFSNGLVN EDLSPYEVES EPDLETKSKN VAESNMFISE YLPTAERNKR       360
     ASPIRLGDSC TLRGPCESPQ GADPYPQDNT QSDQHEHLHA DYSFQVEMGQ DGQQADGEEK       420
     RKLYNNQEER SNEERQFGQV SNGRNQEDQL LLHQGRGQIP CEQNRQALQS HSHVAAKQIP       480
     DKDSKSSVSC QKHAASAPTK NDHRTTRLKE KTKCSYSDLL LEKEYVVVEK KSVEVNALAD       540
     EFAQAGSGAP AIRLPDQHHN DASQALQMAR HSSTSVSAAN TAKQTLLRRN SRTLSSSGAS       600
     TSRRPSLVDR RLSITSLGAT NALSKALGMA SLRLFGNSHQ QSSNGSSTFK QNPNVTSLLS       660
     PQTFQDMTEN AVLSADHQWD NSRQADVLHD DSIMKALENL TAKVYAIYSF AEVKFSQIIP       720
     LPPSSTQDPY THKRMSNGSC AIDDEEDDIE HSPGAETYRK NSSGANANTG NYNFSLDTIH       780
     EMNLNDLPPN DLYILCTEAI VLYMKSLSLL AYAMHLTSKW WHESADKICP LKLNLLVQWI       840
     RERFNECLEK AEFLRMKTQS IQLHNGNQLS ASTMVSEPVF VEKLIYDRAL DISKTAAKME       900
     MQGEYLEGCE VAYSTSLWML EALLDDVSDE DNYNDDNLGH TGVLDKSDKE VIKRYIDSIA       960
     NRLKALRRKL SR                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page