(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE157

ASHGO_3.PE157        Location/Qualifiers
FT   CDS             279017..279802
FT                   /codon_start=1
FT                   /gene_family="HOG000234606" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15747822"
FT                   /gene_name="NSA2"
FT                   /locus_tag="ACL050W"
FT                   /product="Ribosome biogenesis protein NSA2 "
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /cellular_component="ribonucleoprotein complex "
FT                   /protein_id="AAS51178.1"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0030529"
FT                   /db_xref="HOGENOM:HBG011932"
FT                   /db_xref="HOGENOM:HBG396800"
FT                   /db_xref="InterPro:IPR022309"
FT                   /db_xref="UniParc:UPI000025279C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75CG9"
FT                   /transl_table=1
FT                   /translation="MPQNEYIEQHIKKHGRRLDHEERKRKREAREAHKISEKAQKLTGW
FT                   KGKQFAKKRYAEKVAMRKKIKAHEQSKLKGAAKPLEDSGEALPAYLLDREQANSAKAIS
FT                   SSIKQKRLEKADKFSVPLPKVRGISEEEMFKVVKTGKSKTKSWKRMITKHTFVGEGFTR
FT                   RPVKMERIIRPSALRQKKANVTHPELGVTVFLPILGVKKNPQSPMYTQLGVLTKGTIIE
FT                   VNVSELGMVTSGGKVVWGKYAQITNEPDRDGCVNAVLLV"
     MPQNEYIEQH IKKHGRRLDH EERKRKREAR EAHKISEKAQ KLTGWKGKQF AKKRYAEKVA        60
     MRKKIKAHEQ SKLKGAAKPL EDSGEALPAY LLDREQANSA KAISSSIKQK RLEKADKFSV       120
     PLPKVRGISE EEMFKVVKTG KSKTKSWKRM ITKHTFVGEG FTRRPVKMER IIRPSALRQK       180
     KANVTHPELG VTVFLPILGV KKNPQSPMYT QLGVLTKGTI IEVNVSELGM VTSGGKVVWG       240
     KYAQITNEPD RDGCVNAVLL V                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page