(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE16

ASHGO_3.PE16         Location/Qualifiers
FT   CDS             27999..28874
FT                   /codon_start=1
FT                   /gene_family="HOG000222700" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15764783"
FT                   /locus_tag="ACL190W"
FT                   /orf_name="AGOS_ACL190W"
FT                   /product="ACL190Wp"
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds"
FT                   /biological_process="nitrogen compound metabolic process "
FT                   /protein_id="AAS51038.1"
FT                   /db_xref="GO:0006807"
FT                   /db_xref="GO:0016810"
FT                   /db_xref="HOGENOM:HBG460397"
FT                   /db_xref="HOGENOM:HBG742418"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="UniParc:UPI0000252710"
FT                   /db_xref="UniProtKB/TrEMBL:Q75CV6"
FT                   /transl_table=1
FT                   /translation="MSEILRAKVKVALVQLAGSSASKAANLARAGQFIERAMTEQPDTG
FT                   LVVLPECFNAPYEIGKFREFAEVAAEGPESPSVGFLAGQARRWGVTLVGGTIPELEPDT
FT                   QRVYNTCLVFDGKGALVGKHRKVHLFDVDIPGKITFTESRTLAAGRHVTQVDTPAGALG
FT                   VGVCYDLRFPELAMVCARRGAYAMVYPSAFNTTTGPLHWHLLARARSVDNQIYTLLCSP
FT                   ARVAGASYQAYGHSLVVDPTGRVVAEAGEGEEILYATLDPAELDWVRRAIPVTRQRRFD
FT                   VYADVAASSP"
     MSEILRAKVK VALVQLAGSS ASKAANLARA GQFIERAMTE QPDTGLVVLP ECFNAPYEIG        60
     KFREFAEVAA EGPESPSVGF LAGQARRWGV TLVGGTIPEL EPDTQRVYNT CLVFDGKGAL       120
     VGKHRKVHLF DVDIPGKITF TESRTLAAGR HVTQVDTPAG ALGVGVCYDL RFPELAMVCA       180
     RRGAYAMVYP SAFNTTTGPL HWHLLARARS VDNQIYTLLC SPARVAGASY QAYGHSLVVD       240
     PTGRVVAEAG EGEEILYATL DPAELDWVRR AIPVTRQRRF DVYADVAASS P                291
//

If you have problems or comments...

PBIL Back to PBIL home page