(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE166

ASHGO_3.PE166        Location/Qualifiers
FT   CDS             complement(289647..291944)
FT                   /codon_start=1
FT                   /gene_family="HOG000115788" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15747827"
FT                   /locus_tag="AGOS_ACL041C"
FT                   /product="ACL041Cp"
FT                   /function="protein tyrosine phosphatase activity "
FT                   /biological_process="protein dephosphorylation "
FT                   /protein_id="AAS51187.2"
FT                   /db_xref="GO:0004725"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="HOGENOM:HBG058350"
FT                   /db_xref="InterPro:IPR000242"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="UniParc:UPI0001DB27AC"
FT                   /db_xref="UniProtKB/TrEMBL:Q75CG0"
FT                   /transl_table=1
FT                   /translation="MVLKGGEYYRVGYGPGHKSTLSDSVSILSNSSTTAEEGGPGGPAH
FT                   AKTRSAGMVEGPAVPHGSSAYKVGVSAGGGLRFPLHAGCRTMDSRALGNMLNEDANTVV
FT                   VDTRPFVEYSKSHVRGALHVCLPSTLLRRKTFSLARLLENLPPGDRESVRERLREHTQG
FT                   ERSLSIVIYDNLPMKGDGWSSLACAGLSAKFLENNWEAEGQNVPDVYILSDGYQQFQLQ
FT                   FAELSEALPASADDDLLCQPPGLCASASSLSTPSSFRGSPLEPLPSPLTTSPMSQLFKF
FT                   QLPTQRPLQNGSSHAFPRVFKMRHFEENSNLESYLGAVDINENRKLSEFDETSDSNGTR
FT                   FQQSFFKFPLKLSFQLEYAKITELYKQEEIDCVIPKWFQDLMLKPSKMQYVEQFQRLDI
FT                   LERTRLDRILNTPFGDKINSVSTIPCDINDAELANYFDYDKEYDPEITISSGVELGAKN
FT                   RYKDVFPYEHTRVVLRRDSELRSTTVPFEKDSVIDTYINANYLTSPFDSGKKSGSAGRY
FT                   IATQAPLPETIHDFYTCIINNNVPVVLSLTDEFEHGIEKCCKFWADGEYNGIVVSMLEE
FT                   HKGEVLFIRRIKITYNDGKSSYELLQIQIKDWPDLGILDSPKDIIDMIFLKDYVIQQLM
FT                   SDGIFAEDEMPTVLVHCSAGCGRTGTLCTVDSVISNLTEIAHQSEQWASSKSTASGVFD
FT                   PIVTIIDRFRKQRISMVQTITQYLFIYDCMLRYFKIRLETINEGSDSNRVRSLIGEQDI
FT                   LGNFIRSKITAR"
     MVLKGGEYYR VGYGPGHKST LSDSVSILSN SSTTAEEGGP GGPAHAKTRS AGMVEGPAVP        60
     HGSSAYKVGV SAGGGLRFPL HAGCRTMDSR ALGNMLNEDA NTVVVDTRPF VEYSKSHVRG       120
     ALHVCLPSTL LRRKTFSLAR LLENLPPGDR ESVRERLREH TQGERSLSIV IYDNLPMKGD       180
     GWSSLACAGL SAKFLENNWE AEGQNVPDVY ILSDGYQQFQ LQFAELSEAL PASADDDLLC       240
     QPPGLCASAS SLSTPSSFRG SPLEPLPSPL TTSPMSQLFK FQLPTQRPLQ NGSSHAFPRV       300
     FKMRHFEENS NLESYLGAVD INENRKLSEF DETSDSNGTR FQQSFFKFPL KLSFQLEYAK       360
     ITELYKQEEI DCVIPKWFQD LMLKPSKMQY VEQFQRLDIL ERTRLDRILN TPFGDKINSV       420
     STIPCDINDA ELANYFDYDK EYDPEITISS GVELGAKNRY KDVFPYEHTR VVLRRDSELR       480
     STTVPFEKDS VIDTYINANY LTSPFDSGKK SGSAGRYIAT QAPLPETIHD FYTCIINNNV       540
     PVVLSLTDEF EHGIEKCCKF WADGEYNGIV VSMLEEHKGE VLFIRRIKIT YNDGKSSYEL       600
     LQIQIKDWPD LGILDSPKDI IDMIFLKDYV IQQLMSDGIF AEDEMPTVLV HCSAGCGRTG       660
     TLCTVDSVIS NLTEIAHQSE QWASSKSTAS GVFDPIVTII DRFRKQRISM VQTITQYLFI       720
     YDCMLRYFKI RLETINEGSD SNRVRSLIGE QDILGNFIRS KITAR                       765
//

If you have problems or comments...

PBIL Back to PBIL home page