(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE191

ASHGO_3.PE191        Location/Qualifiers
FT   CDS             complement(331299..332384)
FT                   /codon_start=1
FT                   /gene_family="HOG000154501" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15748926"
FT                   /gene_name="TAF4"
FT                   /locus_tag="ACL016C"
FT                   /product="Transcription initiation factor TFIID subunit 4 "
FT                   /function="transcription initiation factor activity "
FT                   /biological_process="transcription initiation, DNA-
FT                   dependent"
FT                   /cellular_component="transcription factor TFIID complex "
FT                   /protein_id="AAS51212.1"
FT                   /db_xref="GO:0005669"
FT                   /db_xref="GO:0006352"
FT                   /db_xref="GO:0016986"
FT                   /db_xref="HOGENOM:HBG123700"
FT                   /db_xref="HOGENOM:HBG203375"
FT                   /db_xref="InterPro:IPR007900"
FT                   /db_xref="UniParc:UPI00002527BE"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75CC5"
FT                   /transl_table=1
FT                   /translation="MGKSPKAADQGDTGAGGKKTKGEDGFSFGIDAEEVEPTGSDFSND
FT                   MPTPFDNFVGQDEQSNRAELPESGQPATTLALPAGGAGSGAGRKSPQKMQRAGMRRAAG
FT                   AGAPKQQSDPDKLSDALLSAGVDIKEEEALLSSTVTTMKSNSQVSNSQIPLHPPFLHPS
FT                   HVASMMKKVAAEQNFNQDFSKSSELLSLMSTACELYIRDIITNSIIISRHRRKAVKLNS
FT                   GRRSETTRVLRDLALKQREQEERRVKRRIALGLEKEITDTKLDSGETLHRASNATANMM
FT                   IAGGKKKYSWLTSGSKVNATDLKNPGKVSSAVAARGDLGIKFREAREEPGIVMRDLLHA
FT                   LENRRVGVNNTIAKGYARIRD"
     MGKSPKAADQ GDTGAGGKKT KGEDGFSFGI DAEEVEPTGS DFSNDMPTPF DNFVGQDEQS        60
     NRAELPESGQ PATTLALPAG GAGSGAGRKS PQKMQRAGMR RAAGAGAPKQ QSDPDKLSDA       120
     LLSAGVDIKE EEALLSSTVT TMKSNSQVSN SQIPLHPPFL HPSHVASMMK KVAAEQNFNQ       180
     DFSKSSELLS LMSTACELYI RDIITNSIII SRHRRKAVKL NSGRRSETTR VLRDLALKQR       240
     EQEERRVKRR IALGLEKEIT DTKLDSGETL HRASNATANM MIAGGKKKYS WLTSGSKVNA       300
     TDLKNPGKVS SAVAARGDLG IKFREAREEP GIVMRDLLHA LENRRVGVNN TIAKGYARIR       360
     D                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page