(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE192

ASHGO_3.PE192        Location/Qualifiers
FT   CDS             332684..333772
FT                   /codon_start=1
FT                   /gene_family="HOG000157670" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15748927"
FT                   /locus_tag="ACL015W"
FT                   /orf_name="AGOS_ACL015W"
FT                   /product="ACL015Wp"
FT                   /function="catalytic activity"
FT                   /protein_id="AAS51213.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG020852"
FT                   /db_xref="HOGENOM:HBG381263"
FT                   /db_xref="InterPro:IPR000228"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR013796"
FT                   /db_xref="InterPro:IPR016443"
FT                   /db_xref="InterPro:IPR020719"
FT                   /db_xref="UniParc:UPI0000151AB2"
FT                   /db_xref="UniProtKB/TrEMBL:Q75CC4"
FT                   /transl_table=1
FT                   /translation="MSSKYVTFRGATNFRHRIVMATLSGKAVKIEKIRSEDMNPGLRDH
FT                   EVSFLRLIEAVTNGSVIEISYTGTTVIYRPGIIVGGSHTHNCPNGKAVGYYVEPLLYLA
FT                   PFSKKKFSIILRGVTSTHQDAGIEAIKWGLMPVMEKFGVRECALHTLKRGAPPLGGGEV
FT                   HLVVDSLIAQPITMHALERPLISAIRGVAYSTRVSPSMVNRMIDGAKSVLKQVPCEANI
FT                   TADVWRGANSGKSPGWGITLVAETKKGWRYFTEAIGDAGEVPEDIGNKAAYNLLEEISR
FT                   SAVVCRSQLPLAIVYMVIGKEDIGRLRIARAQVDESLVLLLRDIKELFGTEALLKPADD
FT                   DTDDLIVTIKGIGFTNTSKKIA"
     MSSKYVTFRG ATNFRHRIVM ATLSGKAVKI EKIRSEDMNP GLRDHEVSFL RLIEAVTNGS        60
     VIEISYTGTT VIYRPGIIVG GSHTHNCPNG KAVGYYVEPL LYLAPFSKKK FSIILRGVTS       120
     THQDAGIEAI KWGLMPVMEK FGVRECALHT LKRGAPPLGG GEVHLVVDSL IAQPITMHAL       180
     ERPLISAIRG VAYSTRVSPS MVNRMIDGAK SVLKQVPCEA NITADVWRGA NSGKSPGWGI       240
     TLVAETKKGW RYFTEAIGDA GEVPEDIGNK AAYNLLEEIS RSAVVCRSQL PLAIVYMVIG       300
     KEDIGRLRIA RAQVDESLVL LLRDIKELFG TEALLKPADD DTDDLIVTIK GIGFTNTSKK       360
     IA                                                                      362
//

If you have problems or comments...

PBIL Back to PBIL home page