(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE193

ASHGO_3.PE193        Location/Qualifiers
FT   CDS             complement(333901..335472)
FT                   /codon_start=1
FT                   /gene_family="HOG000000751" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18927734"
FT                   /gene_name="MVP1"
FT                   /locus_tag="ACL014C"
FT                   /product="Sorting nexin MVP1"
FT                   /function="phosphatidylinositol binding"
FT                   /biological_process="cell communication"
FT                   /biological_process="protein transport"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS51214.2"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0007154"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0035091"
FT                   /db_xref="HOGENOM:HBG058360"
FT                   /db_xref="HOGENOM:HBG203374"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="UniParc:UPI0001DB27C8"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75CC3"
FT                   /transl_table=1
FT                   /translation="MMDLDSQELWGRGPSMESPNNAWASVQRTPADSARTQQIVSPVVR
FT                   QAESLGSLTLTDSSLSAEVKETMRNNYNERKMYEPGTPALEQTVWGAPPSQLDASISGL
FT                   DTSMAPVASQSSMCDELHSEDLENWMNSRRKTYNPLAKNIVVVEEIPEREGILFKHTNY
FT                   LVKHLVVLPNTNPSSNQTVIRRYSDFNWLQEVLLKKYPFRMIPELPPKKIGAQNADPIF
FT                   LARRRKGLCRFINLVIMHPVLKQDDLVLTFLTVPTDLGSWRKQANYDTTEEFTDQKIDK
FT                   AFISLWHKELSNQWNKADAKIDELLESWIKTSVLVERYERRMRQVSEERRLLGRVIEEF
FT                   ADNSVTLYPLEEGTIHDINSHISTISKHLNSLADTSKKERQEVEEHLSVKFKTFIDIII
FT                   ALKGVFDRYKIMAGNNIAHLQRRVEINMDKLQSMESNPDVKGAEYDKLRQTIQRDKRTI
FT                   AEQLNRSWLIRKCILEEFVIFQETQFCITHVFQEWAKMHVKYANETTESWEKVYANLQD
FT                   MPLSRS"
     MMDLDSQELW GRGPSMESPN NAWASVQRTP ADSARTQQIV SPVVRQAESL GSLTLTDSSL        60
     SAEVKETMRN NYNERKMYEP GTPALEQTVW GAPPSQLDAS ISGLDTSMAP VASQSSMCDE       120
     LHSEDLENWM NSRRKTYNPL AKNIVVVEEI PEREGILFKH TNYLVKHLVV LPNTNPSSNQ       180
     TVIRRYSDFN WLQEVLLKKY PFRMIPELPP KKIGAQNADP IFLARRRKGL CRFINLVIMH       240
     PVLKQDDLVL TFLTVPTDLG SWRKQANYDT TEEFTDQKID KAFISLWHKE LSNQWNKADA       300
     KIDELLESWI KTSVLVERYE RRMRQVSEER RLLGRVIEEF ADNSVTLYPL EEGTIHDINS       360
     HISTISKHLN SLADTSKKER QEVEEHLSVK FKTFIDIIIA LKGVFDRYKI MAGNNIAHLQ       420
     RRVEINMDKL QSMESNPDVK GAEYDKLRQT IQRDKRTIAE QLNRSWLIRK CILEEFVIFQ       480
     ETQFCITHVF QEWAKMHVKY ANETTESWEK VYANLQDMPL SRS                         523
//

If you have problems or comments...

PBIL Back to PBIL home page