(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE195

ASHGO_3.PE195        Location/Qualifiers
FT   CDS             336672..337286
FT                   /codon_start=1
FT                   /gene_family="HOG000000776" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20622160"
FT                   /gene_name="COQ10"
FT                   /locus_tag="ACL012W"
FT                   /product="Coenzyme Q-binding protein COQ10, mitochondrial "
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="AAS51216.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="HOGENOM:HBG110424"
FT                   /db_xref="HOGENOM:HBG397391"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="UniParc:UPI00002527C1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75CC1"
FT                   /transl_table=1
FT                   /translation="MLRCLISRPQLLPTRLPLATPSCVSRRTFLGFTGGDTKEQRYILK
FT                   RVFNAPLHYVYPAVSEVSLYKLFIPYCTDSFVNKRRPGDNMPTEAGLRVGFQQYDETFV
FT                   CRVDCTTLPGNQRSVVAESLAHHLFETLHTQWLLSPHPTRPDASVVELILRFKFKSQLY
FT                   NSVSSIFGTRVTQVVMKAFEKRVFQLRKEAMDRPPTGDAGH"
     MLRCLISRPQ LLPTRLPLAT PSCVSRRTFL GFTGGDTKEQ RYILKRVFNA PLHYVYPAVS        60
     EVSLYKLFIP YCTDSFVNKR RPGDNMPTEA GLRVGFQQYD ETFVCRVDCT TLPGNQRSVV       120
     AESLAHHLFE TLHTQWLLSP HPTRPDASVV ELILRFKFKS QLYNSVSSIF GTRVTQVVMK       180
     AFEKRVFQLR KEAMDRPPTG DAGH                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page