(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE196

ASHGO_3.PE196        Location/Qualifiers
FT   CDS             complement(337455..338300)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18927735"
FT                   /gene_name="AIM34"
FT                   /locus_tag="ACL011C"
FT                   /product="Altered inheritance of mitochondria protein 34,
FT                   mitochondrial"
FT                   /function="nucleic acid binding"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial membrane"
FT                   /protein_id="AAS51217.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0031966"
FT                   /db_xref="HOGENOM:HBG058362"
FT                   /db_xref="HOGENOM:HBG103675"
FT                   /db_xref="InterPro:IPR003034"
FT                   /db_xref="UniParc:UPI00002527C2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75CC0"
FT                   /transl_table=1
FT                   /translation="MSLRRAKSLPSLKNIAEVAKPITKAPPLPLLAFEGPGLSTCRWYP
FT                   TTVRTVHNTPSKAQTTLLSTAKKESAFSAMNLKALRNECRSRGLQVSGRKSDLIERIVD
FT                   FELKGPLGRRGTRRAFHSPGTSSASVCRPVDKVTMPDIALTERAVQQPEKNYILRIPSL
FT                   SREAASHPVTKSEKDLAQGADEDADPTSEEGRVLTPDSDLHIESPVVINKIEIINEDDY
FT                   LQDDSRQSSDSQGGSQQDSDGTGQQNFSPRDRRFFAGLTAAVGLWWYFGNKSAKRRMRK
FT                   "
     MSLRRAKSLP SLKNIAEVAK PITKAPPLPL LAFEGPGLST CRWYPTTVRT VHNTPSKAQT        60
     TLLSTAKKES AFSAMNLKAL RNECRSRGLQ VSGRKSDLIE RIVDFELKGP LGRRGTRRAF       120
     HSPGTSSASV CRPVDKVTMP DIALTERAVQ QPEKNYILRI PSLSREAASH PVTKSEKDLA       180
     QGADEDADPT SEEGRVLTPD SDLHIESPVV INKIEIINED DYLQDDSRQS SDSQGGSQQD       240
     SDGTGQQNFS PRDRRFFAGL TAAVGLWWYF GNKSAKRRMR K                           281
//

If you have problems or comments...

PBIL Back to PBIL home page