(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE20

ASHGO_3.PE20         Location/Qualifiers
FT   CDS             33458..34162
FT                   /codon_start=1
FT                   /gene_family="HOG000201506" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15747753"
FT                   /locus_tag="ACL186W"
FT                   /orf_name="AGOS_ACL186W"
FT                   /product="ACL186Wp"
FT                   /function="catalytic activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS51042.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG058366"
FT                   /db_xref="HOGENOM:HBG395435"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR016118"
FT                   /db_xref="UniParc:UPI0000252714"
FT                   /db_xref="UniProtKB/TrEMBL:Q75CV2"
FT                   /transl_table=1
FT                   /translation="MIGTQMFPMDNLIPFDDTYVLYDPNDIVSFISCYFSLLPIAILVF
FT                   YFSWFVTNREMEAVFIAIGHLMNEILNNVVKNVIREPRPNNFGTFQKETLRSGFGMPSA
FT                   HSQFMGFFALYHCMRIWLQWTGLRRVHKVLGSVAVVIATTCVAGSRVYLGYHDVPQVLV
FT                   GVSIGAFLGSLYFLLVGLIRHSGLSDWVLTWRLAKWFLVKDSCYHAPISLREEYEAYWR
FT                   RRSRIEGPGKTE"
     MIGTQMFPMD NLIPFDDTYV LYDPNDIVSF ISCYFSLLPI AILVFYFSWF VTNREMEAVF        60
     IAIGHLMNEI LNNVVKNVIR EPRPNNFGTF QKETLRSGFG MPSAHSQFMG FFALYHCMRI       120
     WLQWTGLRRV HKVLGSVAVV IATTCVAGSR VYLGYHDVPQ VLVGVSIGAF LGSLYFLLVG       180
     LIRHSGLSDW VLTWRLAKWF LVKDSCYHAP ISLREEYEAY WRRRSRIEGP GKTE             234
//

If you have problems or comments...

PBIL Back to PBIL home page