(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE201

ASHGO_3.PE201        Location/Qualifiers
FT   CDS             344392..346521
FT                   /codon_start=1
FT                   /gene_family="HOG000248546" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19774717"
FT                   /locus_tag="AGOS_ACL006W"
FT                   /product="ACL006Wp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS51222.2"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG340221"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000959"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015728"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI0001DB27CD"
FT                   /db_xref="UniProtKB/TrEMBL:Q75CB5"
FT                   /transl_table=1
FT                   /translation="MSAPLQIVNEKQLNTRSNANVHTPVKQHHAKRADLERGHHDNNRQ
FT                   PPQKKKKEKLSALCKTPPSLIKTKGRDYHRGMFLGEGGFARCFQMKDDSGKVFAAKTVA
FT                   KISIKSEKTRKKLLSEIQIHKSMKHPNIVQFTDCFEDDTNVYILLEICPNGSLMDLLKQ
FT                   RKQLTEPEVRFFTTQIVGAIKYMHSRRIIHRDLKLGNIFFDKHFNLKIGDFGLAAVLAN
FT                   DRERKYTICGTPNYIAPEVLTGKHTGHSFEVDIWSIGVMIYALLIGKPPFQAKEVNTIY
FT                   ERIKVCDFSFPKDKPISSEAKVLIKDILSLDPLERPSLAEIMEYVWFRNVFPARINGDI
FT                   LNFVPEFHDLDLQESLINFKNCMAKCGLMNPSAAAAAVAAKEYDQRLPSYSKNSNNNNN
FT                   QINQNNEQLSEAKKSVLPQSLSPGGTRYKYKEIVDVETQRKLNDLAREARIRRAQQSML
FT                   KQSLVASSTNFIKSEISLRILASECHMTLNGLLEAEAQKRMGGLPRSRLPEIQHPIVVT
FT                   KWVDYSNKHGFAYQLSTDDIGVLFNNGTTVLNLADAEEFWYISYDDREGWVANHYSLAE
FT                   KPKELNRHLEVVDFFSNYMNSNLSRISTFVRESYHKDDVFLRRFTRYKQFVMFELSDGT
FT                   FQFNFKDHHKFAISQSGKLTTYISPDRQSFTFPTVEILKAEKIPGHPELGFMEKFAMIK
FT                   EGLKQKSAIVSVAQQ"
     MSAPLQIVNE KQLNTRSNAN VHTPVKQHHA KRADLERGHH DNNRQPPQKK KKEKLSALCK        60
     TPPSLIKTKG RDYHRGMFLG EGGFARCFQM KDDSGKVFAA KTVAKISIKS EKTRKKLLSE       120
     IQIHKSMKHP NIVQFTDCFE DDTNVYILLE ICPNGSLMDL LKQRKQLTEP EVRFFTTQIV       180
     GAIKYMHSRR IIHRDLKLGN IFFDKHFNLK IGDFGLAAVL ANDRERKYTI CGTPNYIAPE       240
     VLTGKHTGHS FEVDIWSIGV MIYALLIGKP PFQAKEVNTI YERIKVCDFS FPKDKPISSE       300
     AKVLIKDILS LDPLERPSLA EIMEYVWFRN VFPARINGDI LNFVPEFHDL DLQESLINFK       360
     NCMAKCGLMN PSAAAAAVAA KEYDQRLPSY SKNSNNNNNQ INQNNEQLSE AKKSVLPQSL       420
     SPGGTRYKYK EIVDVETQRK LNDLAREARI RRAQQSMLKQ SLVASSTNFI KSEISLRILA       480
     SECHMTLNGL LEAEAQKRMG GLPRSRLPEI QHPIVVTKWV DYSNKHGFAY QLSTDDIGVL       540
     FNNGTTVLNL ADAEEFWYIS YDDREGWVAN HYSLAEKPKE LNRHLEVVDF FSNYMNSNLS       600
     RISTFVRESY HKDDVFLRRF TRYKQFVMFE LSDGTFQFNF KDHHKFAISQ SGKLTTYISP       660
     DRQSFTFPTV EILKAEKIPG HPELGFMEKF AMIKEGLKQK SAIVSVAQQ                   709
//

If you have problems or comments...

PBIL Back to PBIL home page