(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE202

ASHGO_3.PE202        Location/Qualifiers
FT   CDS             complement(346569..346937)
FT                   /codon_start=1
FT                   /gene_family="HOG000179862" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18078979"
FT                   /locus_tag="ACL005C"
FT                   /orf_name="AGOS_ACL005C"
FT                   /product="ACL005Cp"
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /function="protein dimerization activity"
FT                   /protein_id="AAS51223.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="HOGENOM:HBG410450"
FT                   /db_xref="HOGENOM:HBG726964"
FT                   /db_xref="InterPro:IPR008193"
FT                   /db_xref="InterPro:IPR009025"
FT                   /db_xref="InterPro:IPR011261"
FT                   /db_xref="UniParc:UPI00002527C8"
FT                   /db_xref="UniProtKB/TrEMBL:Q75CF1"
FT                   /transl_table=1
FT                   /translation="MNAPDRFELFLLPEGESKLKIEPDTKAANAVIITFEKEDHTLGNI
FT                   IRAELLEDERVLFAAYKVEHPLFARFRMRIQTAEGYDPKEALKNACNSIINKLATLKSN
FT                   FETEWNLQTLASEDQFRL"
     MNAPDRFELF LLPEGESKLK IEPDTKAANA VIITFEKEDH TLGNIIRAEL LEDERVLFAA        60
     YKVEHPLFAR FRMRIQTAEG YDPKEALKNA CNSIINKLAT LKSNFETEWN LQTLASEDQF       120
     RL                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page