(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE216

ASHGO_3.PE216        Location/Qualifiers
FT   CDS             complement(374084..376921)
FT                   /codon_start=1
FT                   /gene_family="HOG000248614" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15748939"
FT                   /gene_name="CIN8"
FT                   /locus_tag="ACR010C"
FT                   /product="Kinesin-like protein CIN8 "
FT                   /function="ATP binding"
FT                   /function="microtubule motor activity"
FT                   /biological_process="cell division"
FT                   /biological_process="microtubule-based movement "
FT                   /biological_process="mitosis"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="microtubule"
FT                   /cellular_component="spindle"
FT                   /protein_id="AAS51237.1"
FT                   /db_xref="EMBL:AAN87133.1"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0005819"
FT                   /db_xref="GO:0005874"
FT                   /db_xref="GO:0007018"
FT                   /db_xref="GO:0007067"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG398095"
FT                   /db_xref="HOGENOM:HBG525807"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR019821"
FT                   /db_xref="UniParc:UPI000006CAFA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8J1G7"
FT                   /transl_table=1
FT                   /translation="MPDHEVQTRKSRMLDDAQEELNITVAVRCRGRNEREIKAKSSVVV
FT                   TVPDVTGSNEVSINTTDEVGIAAKMNSRTYTVDKVFGPSADQSLIFKEIAEPLFDDFMK
FT                   GYNCTVLVYGMTSTGKTYTMTGDEKLYDGQLSDSAGIIPRIMFKLFDALEATDSDFLVK
FT                   CSYIELYNEELKDLLDESHDSSKRLRIFDSSSMNHSSRASSQSNSPREPEVAHNGFSRR
FT                   RQRPPPVKANRMSATKQQLSESGSGIYVQNVQEFHIINAREGINVLQKGLKHRQVASTK
FT                   MNDFSSRSHTIFTIMLYKNCDGELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQ
FT                   SLLTLGRVINSLADKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSST
FT                   LEYAAKAKNIKNRPQLGALMMKDILVKNISSELAKIKSDFLSTKSKDGIYMSHEHYQEI
FT                   VNDLENCQTEIQESKRQIESLTSQNNLLLKDKKASQEVTELQNSKIKKLQSTIEYLYDK
FT                   IERQHHNETELATTIHKLKEALHTMQGSLKSYETHELRLQNDIKEVLYQGITSYRESMN
FT                   QHLEKVKVSMLDKNLSIKENINNITTIFDDTLKSVEANGSDMCDTLVKLIKETPSMYLK
FT                   EFNETVSSLKSELSSYSNALTNKLTEISEENNHLREYLDQHLFKNSTQEVLDLRMESVY
FT                   QKVKNDSDQLLSKLVSMVGAHVEESRTLMVNSMKDTVNEIIDNERSLFQPIRDRWIASC
FT                   DNINQCDASHQNFEAKSTSGLDKLKELSDASLKSSEDAVNKAKHRTDSFHDFVQKLCCD
FT                   QSLKKQMHDISDKHRMLEDHFDDNVKYFKESSKGFEDMDCSIKKIIHEMSPEVGDIKSV
FT                   ETLMERINARTFSPVRPTGKTPSRQVLKNAITSKASSRSMSPIKTLDTNVRIISPVKRG
FT                   TIEFGAEGPPTKKVR"
     MPDHEVQTRK SRMLDDAQEE LNITVAVRCR GRNEREIKAK SSVVVTVPDV TGSNEVSINT        60
     TDEVGIAAKM NSRTYTVDKV FGPSADQSLI FKEIAEPLFD DFMKGYNCTV LVYGMTSTGK       120
     TYTMTGDEKL YDGQLSDSAG IIPRIMFKLF DALEATDSDF LVKCSYIELY NEELKDLLDE       180
     SHDSSKRLRI FDSSSMNHSS RASSQSNSPR EPEVAHNGFS RRRQRPPPVK ANRMSATKQQ       240
     LSESGSGIYV QNVQEFHIIN AREGINVLQK GLKHRQVAST KMNDFSSRSH TIFTIMLYKN       300
     CDGELFRVSK MNLVDLAGSE NISRSGAQNQ RAKEAGSINQ SLLTLGRVIN SLADKSIHIP       360
     FRESKLTRLL QDSLGGNTKT ALIATISPAK INADETSSTL EYAAKAKNIK NRPQLGALMM       420
     KDILVKNISS ELAKIKSDFL STKSKDGIYM SHEHYQEIVN DLENCQTEIQ ESKRQIESLT       480
     SQNNLLLKDK KASQEVTELQ NSKIKKLQST IEYLYDKIER QHHNETELAT TIHKLKEALH       540
     TMQGSLKSYE THELRLQNDI KEVLYQGITS YRESMNQHLE KVKVSMLDKN LSIKENINNI       600
     TTIFDDTLKS VEANGSDMCD TLVKLIKETP SMYLKEFNET VSSLKSELSS YSNALTNKLT       660
     EISEENNHLR EYLDQHLFKN STQEVLDLRM ESVYQKVKND SDQLLSKLVS MVGAHVEESR       720
     TLMVNSMKDT VNEIIDNERS LFQPIRDRWI ASCDNINQCD ASHQNFEAKS TSGLDKLKEL       780
     SDASLKSSED AVNKAKHRTD SFHDFVQKLC CDQSLKKQMH DISDKHRMLE DHFDDNVKYF       840
     KESSKGFEDM DCSIKKIIHE MSPEVGDIKS VETLMERINA RTFSPVRPTG KTPSRQVLKN       900
     AITSKASSRS MSPIKTLDTN VRIISPVKRG TIEFGAEGPP TKKVR                       945
//

If you have problems or comments...

PBIL Back to PBIL home page