(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE218

ASHGO_3.PE218        Location/Qualifiers
FT   CDS             complement(378749..380374)
FT                   /codon_start=1
FT                   /gene_family="HOG000199176" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19774719"
FT                   /locus_tag="ACR012C"
FT                   /orf_name="AGOS_ACR012C"
FT                   /product="ACR012Cp"
FT                   /function="identical protein binding"
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="negative regulation of catalytic
FT                   activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="AAS51239.1"
FT                   /db_xref="GO:0004252"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0042802"
FT                   /db_xref="GO:0043086"
FT                   /db_xref="HOGENOM:HBG540727"
FT                   /db_xref="HOGENOM:HBG752219"
FT                   /db_xref="HSSP:1AH2"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR009020"
FT                   /db_xref="InterPro:IPR010259"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="UniParc:UPI00002527D7"
FT                   /db_xref="UniProtKB/TrEMBL:Q75CA0"
FT                   /transl_table=1
FT                   /translation="MKLQRAVWPAVALTTAQALLILPQAEDELVVAEAHRGQLVQWMAR
FT                   ENQERKAQGAEQQSPLFRVDDVTRAIPHKYIVVFREGVSDEEAAFHMELVEAAHAESVA
FT                   RLDEQHAFFRSTRGENNEFGIAATRAEGGIEGEFALGEQLRGYVGYFTEDMVGLLRSNP
FT                   HVHFVEEDSMVFASDFTTQNGAPWGLARVSHREKLNSGSFNKYLYDDNSGEGVTSYVID
FT                   TGINIDHVDFEDRALWGKTIPNNDADYDGNGHGTHCAGTIASKTYGVAKKANVVAVKVL
FT                   RSNGTGSMSDVLRGVEYAVKAHRKAAEKADKGFKGSTANMSLGGGRSQALDLAVDAAVD
FT                   AGIHFAVAAGNENQDACNTSPAASQKAITVGASTLADDRAYFSNWGRCVDLFAPGMNIL
FT                   STYIGSDTAVATLSGTSMASPHVAGLLTYFLSLQPDGDSEFRNKQTISPEVLKKKVIDF
FT                   GTKDALSSLPARTANVLIYNGGGADLSDFWGNKPKKVSGPKFTYADDEEAMGSDLDRLI
FT                   HELESSTDAMFSGFRTILDRMNII"
     MKLQRAVWPA VALTTAQALL ILPQAEDELV VAEAHRGQLV QWMARENQER KAQGAEQQSP        60
     LFRVDDVTRA IPHKYIVVFR EGVSDEEAAF HMELVEAAHA ESVARLDEQH AFFRSTRGEN       120
     NEFGIAATRA EGGIEGEFAL GEQLRGYVGY FTEDMVGLLR SNPHVHFVEE DSMVFASDFT       180
     TQNGAPWGLA RVSHREKLNS GSFNKYLYDD NSGEGVTSYV IDTGINIDHV DFEDRALWGK       240
     TIPNNDADYD GNGHGTHCAG TIASKTYGVA KKANVVAVKV LRSNGTGSMS DVLRGVEYAV       300
     KAHRKAAEKA DKGFKGSTAN MSLGGGRSQA LDLAVDAAVD AGIHFAVAAG NENQDACNTS       360
     PAASQKAITV GASTLADDRA YFSNWGRCVD LFAPGMNILS TYIGSDTAVA TLSGTSMASP       420
     HVAGLLTYFL SLQPDGDSEF RNKQTISPEV LKKKVIDFGT KDALSSLPAR TANVLIYNGG       480
     GADLSDFWGN KPKKVSGPKF TYADDEEAMG SDLDRLIHEL ESSTDAMFSG FRTILDRMNI       540
     I                                                                       541
//

If you have problems or comments...

PBIL Back to PBIL home page