(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE22

ASHGO_3.PE22         Location/Qualifiers
FT   CDS             join(complement(36965..36983),complement(36438..36802))
FT                   /codon_start=1
FT                   /gene_family="HOG000216571" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19774427"
FT                   /locus_tag="ACL184C"
FT                   /orf_name="AGOS_ACL184C"
FT                   /product="ACL184Cp"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="large ribosomal subunit"
FT                   /protein_id="AAS51044.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015934"
FT                   /db_xref="HOGENOM:HBG324580"
FT                   /db_xref="HOGENOM:HBG714769"
FT                   /db_xref="InterPro:IPR005756"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014723"
FT                   /db_xref="UniParc:UPI0000252716"
FT                   /db_xref="UniProtKB/TrEMBL:Q75CV0"
FT                   /transl_table=1
FT                   /translation="MAKQSLDVSSDRRKARKAYFNAPSSERRVIMSAPLSKELREQYNI
FT                   KSLPIRKDDEIMVVRGSKKGQEGKVSSVYRLKYAVRVDKVTKEKSNGASVPLDVHPSKV
FT                   VITKLHLDKDRKALIERKGGKLE"
     MAKQSLDVSS DRRKARKAYF NAPSSERRVI MSAPLSKELR EQYNIKSLPI RKDDEIMVVR        60
     GSKKGQEGKV SSVYRLKYAV RVDKVTKEKS NGASVPLDVH PSKVVITKLH LDKDRKALIE       120
     RKGGKLE                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page