(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE223

ASHGO_3.PE223        Location/Qualifiers
FT   CDS             387121..388392
FT                   /codon_start=1
FT                   /gene_family="HOG000160330" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18078981"
FT                   /gene_name="HAT2"
FT                   /locus_tag="ACR017W"
FT                   /product="Histone acetyltransferase type B subunit 2 "
FT                   /EC_number="2.3.1.48"
FT                   /function="histone acetyltransferase activity"
FT                   /biological_process="DNA repair"
FT                   /biological_process="chromatin modification"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS51244.1"
FT                   /db_xref="GO:0004402"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="HOGENOM:HBG021032"
FT                   /db_xref="HOGENOM:HBG435352"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR022052"
FT                   /db_xref="UniParc:UPI00002527DC"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75C99"
FT                   /transl_table=1
FT                   /translation="MTTKLKGLKELGNTSDPLRTVSYQVRTKMSDYEDDNTDVQSLTVE
FT                   EEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPSDGQSPEQSLIFGTHTAGEEVNYLKV
FT                   ATINLPAGIAGLDQGDEEDEANDHSSFAIANKFPHIEEVIRARYMPANSNIIATINGKG
FT                   TISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKP
FT                   KSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTLSF
FT                   SKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDR
FT                   RAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVI
FT                   QAWKVSMKLVNASPPAISDPSLLV"
     MTTKLKGLKE LGNTSDPLRT VSYQVRTKMS DYEDDNTDVQ SLTVEEEYEL WNSNVPVMYE        60
     FVSETKLTWP SLTIQWLPSD GQSPEQSLIF GTHTAGEEVN YLKVATINLP AGIAGLDQGD       120
     EEDEANDHSS FAIANKFPHI EEVIRARYMP ANSNIIATIN GKGTISIFDR TLEESKAQVS       180
     TLAFHKENGY GLAFNPHISG ELLSGSDDTT VALWDIEAAK KPKSILTSHD DIVNDVKWHE       240
     FESNVFGTVS EDKTLQVHDK RVRLEPVKKL PTASPFNTLS FSKHSRNLLA AAGVDSQIYL       300
     YDMRDMSSPL HVMSGHQDSV TTVEFSPHTD GIICSSGSDR RAIIWDLTQI GAEQSQDDAD       360
     DGAPELMMMH AGHRSPVNEF SFNPQIPWLL ASTEEDNVIQ AWKVSMKLVN ASPPAISDPS       420
     LLV                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page