(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE227

ASHGO_3.PE227        Location/Qualifiers
FT   CDS             394892..395080
FT                   /codon_start=1
FT                   /gene_family="HOG000214506" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15748943"
FT                   /locus_tag="ACR021W"
FT                   /orf_name="AGOS_ACR021W"
FT                   /product="ACR021Wp"
FT                   /function="hydrogen ion transporting ATP synthase activity,
FT                   rotational mechanism"
FT                   /function="proton-transporting ATPase activity, rotational
FT                   mechanism"
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="mitochondrial proton-transporting ATP
FT                   synthase complex, catalytic core F(1)"
FT                   /protein_id="AAS51248.1"
FT                   /db_xref="GO:0000275"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0046933"
FT                   /db_xref="GO:0046961"
FT                   /db_xref="HOGENOM:HBG062564"
FT                   /db_xref="InterPro:IPR006721"
FT                   /db_xref="UniParc:UPI00002527E0"
FT                   /db_xref="UniProtKB/TrEMBL:Q75C95"
FT                   /transl_table=1
FT                   /translation="MSAWRKAGLTYNSYLAVAARTVRAALKKELQSPAVLNRSVTEAKV
FT                   IDYASKGSAAEAVPLRK"
     MSAWRKAGLT YNSYLAVAAR TVRAALKKEL QSPAVLNRSV TEAKVIDYAS KGSAAEAVPL        60
     RK                                                                       62
//

If you have problems or comments...

PBIL Back to PBIL home page