(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE23

ASHGO_3.PE23         Location/Qualifiers
FT   CDS             37474..38178
FT                   /codon_start=1
FT                   /gene_family="HOG000093236" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15747754"
FT                   /gene_name="TIM21"
FT                   /locus_tag="ACL183W"
FT                   /product="Mitochondrial import inner membrane translocase
FT                   subunit TIM21"
FT                   /biological_process="protein transport"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="AAS51045.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG058380"
FT                   /db_xref="HOGENOM:HBG204342"
FT                   /db_xref="InterPro:IPR013261"
FT                   /db_xref="UniParc:UPI0000252717"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75CX4"
FT                   /transl_table=1
FT                   /translation="MLAFGSICGRLRAPAGAGLRVNVGKMPGRAWQVANGQPYSTFYAP
FT                   PEQAGNRQKERRVTAWKKVRAAATFSASGMLVLGAAGVAGIVLYLILSELFSPSGDTQI
FT                   FNRAVSTVEGDAVARSLLQCEDGVHRSERLKAYGDSVGDDRWTRNRPISSTRRLDASGR
FT                   EHYYMRFHVETGRRRGVVSLEAQQSDDSYQPEFVRMYLDVPGEKRHYLIRPEPSVAKPK
FT                   GFLGLNWGPRKD"
     MLAFGSICGR LRAPAGAGLR VNVGKMPGRA WQVANGQPYS TFYAPPEQAG NRQKERRVTA        60
     WKKVRAAATF SASGMLVLGA AGVAGIVLYL ILSELFSPSG DTQIFNRAVS TVEGDAVARS       120
     LLQCEDGVHR SERLKAYGDS VGDDRWTRNR PISSTRRLDA SGREHYYMRF HVETGRRRGV       180
     VSLEAQQSDD SYQPEFVRMY LDVPGEKRHY LIRPEPSVAK PKGFLGLNWG PRKD             234
//

If you have problems or comments...

PBIL Back to PBIL home page