(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE24

ASHGO_3.PE24         Location/Qualifiers
FT   CDS             complement(38290..39900)
FT                   /codon_start=1
FT                   /gene_family="HOG000164982" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20621884"
FT                   /locus_tag="ACL182C"
FT                   /orf_name="AGOS_ACL182C"
FT                   /product="ACL182Cp"
FT                   /function="catalytic activity"
FT                   /function="cation binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="AAS51046.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG056738"
FT                   /db_xref="HOGENOM:HBG737647"
FT                   /db_xref="InterPro:IPR004886"
FT                   /db_xref="InterPro:IPR012946"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0000252718"
FT                   /db_xref="UniProtKB/TrEMBL:Q75CX3"
FT                   /transl_table=1
FT                   /translation="MKLQAVLAKTALFSAAVAKASQNTTLAQSGLPVIEVVGNKFFDSR
FT                   SGEQFFIKGIAYQPSSAPQELEVGYPADTKYIDPLAEVEICKRDLPYLKKLGVNTIRVY
FT                   SIDPTKPHDVCMEELSKLGIYVLIDLSEPDTSIIRETPTWDVKVFQRYKDVVDSMQKYN
FT                   NVLGFFAGNEVTNDRTNTDASPFVKAAIRDVKNYIKQMGYRTLPVGYSTNDDQETRDHL
FT                   ADYFVCGSVSADFYGINMYEWCGHSSYGTSGYRERTNEFRNFPVPVFFSEFGCNTIRPR
FT                   PFTEIQALYGTMMTPVWSGGLAYMYFEEDNEYGVVKVTKDNQVLELPDFRNLQKEFEKA
FT                   RPKGVKRSVYEKTYKVNSRTCPEKSATWKASEELPPTPDARKCGCLEQALPCLSLSLQD
FT                   PMSYKNYFEYVCGFVNCMDINGDGSLGVYGEYSDCDTRQKLSLQLSKLYLRRKISKNEC
FT                   PIASNDFFFNAKSIGIPQQCQGVMEDVKVQANKKLVEPKPAAPAGKDVNAAGSSALHRL
FT                   NTATLVLVSTTAFIFHLLL"
     MKLQAVLAKT ALFSAAVAKA SQNTTLAQSG LPVIEVVGNK FFDSRSGEQF FIKGIAYQPS        60
     SAPQELEVGY PADTKYIDPL AEVEICKRDL PYLKKLGVNT IRVYSIDPTK PHDVCMEELS       120
     KLGIYVLIDL SEPDTSIIRE TPTWDVKVFQ RYKDVVDSMQ KYNNVLGFFA GNEVTNDRTN       180
     TDASPFVKAA IRDVKNYIKQ MGYRTLPVGY STNDDQETRD HLADYFVCGS VSADFYGINM       240
     YEWCGHSSYG TSGYRERTNE FRNFPVPVFF SEFGCNTIRP RPFTEIQALY GTMMTPVWSG       300
     GLAYMYFEED NEYGVVKVTK DNQVLELPDF RNLQKEFEKA RPKGVKRSVY EKTYKVNSRT       360
     CPEKSATWKA SEELPPTPDA RKCGCLEQAL PCLSLSLQDP MSYKNYFEYV CGFVNCMDIN       420
     GDGSLGVYGE YSDCDTRQKL SLQLSKLYLR RKISKNECPI ASNDFFFNAK SIGIPQQCQG       480
     VMEDVKVQAN KKLVEPKPAA PAGKDVNAAG SSALHRLNTA TLVLVSTTAF IFHLLL           536
//

If you have problems or comments...

PBIL Back to PBIL home page