(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE242

ASHGO_3.PE242        Location/Qualifiers
FT   CDS             complement(423040..425295)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18927740"
FT                   /gene_name="FYV8"
FT                   /locus_tag="ACR036C"
FT                   /product="Protein FYV8"
FT                   /protein_id="AAS51263.2"
FT                   /db_xref="HOGENOM:HBG058388"
FT                   /db_xref="UniParc:UPI0001DB2802"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75C80"
FT                   /transl_table=1
FT                   /translation="MPDKVNRRKSQRWVSVSKGNYDGADWDSDYSGEELESSPTRQHET
FT                   ICKLPELPKLNLGGSTEERGRPGSGDGLAPRGAAEEEAASSGRGAATPAHEVQTPRSGA
FT                   AAQKFSLTSSSRSVSSMNKELDTLMDEISKEMTAGGSEPPLVETRQSPVDFNRVGVPAL
FT                   KPEGHLADDSSDSDGEDAAGGSSLSQSFEHLNMSLKTDTASGQAMPLSSPRGSSALPAG
FT                   RDSLALKKGASPDRASEGSLSSRSEDLLAVDRTAGENTRLKTTNSSDDDTDSLPELITS
FT                   DAKFRADGASGPARVVSSGVETVIHRAIAPEVAPRLRITSKTDLSYRYDTSSEDDSEAY
FT                   SGIEDDYLSYQPSPNISDAATFHGHRSRTGSPARAPHPLVEQEEHIELPVISDDDSTSK
FT                   SSVRDNYYSEESDNTTSQALVTQDNSSHDTIHDTIRERSFDKSTSGSVTHSIPVIKDDN
FT                   EDWQNQLRQQSVHLGAWNPDTEGKRGAFLTQASPMSTNKGMCGSQDEETTGDDQQLAEP
FT                   CNDDSDSVWEGFPSVGEYEDLQSVADIKTIYDNQTLYNVPGIITSSTSVPPLPSSMSEL
FT                   TSRQDTSILSESTSGSGLDSDSLMRVVEGQRHAPKPSMFKENFGQTPEVQVEHLVNSPV
FT                   PSLDICALIEGPQSHSFKRDKLNSHIEDLNAYSSGAQTWIKYALKSTQSSSNITFDEYV
FT                   ISKHVQDAYAQAEEVSKKHSVTNAVNQNVSQLRKKVFSHSMKEGAKGLLSSIGKKKL"
     MPDKVNRRKS QRWVSVSKGN YDGADWDSDY SGEELESSPT RQHETICKLP ELPKLNLGGS        60
     TEERGRPGSG DGLAPRGAAE EEAASSGRGA ATPAHEVQTP RSGAAAQKFS LTSSSRSVSS       120
     MNKELDTLMD EISKEMTAGG SEPPLVETRQ SPVDFNRVGV PALKPEGHLA DDSSDSDGED       180
     AAGGSSLSQS FEHLNMSLKT DTASGQAMPL SSPRGSSALP AGRDSLALKK GASPDRASEG       240
     SLSSRSEDLL AVDRTAGENT RLKTTNSSDD DTDSLPELIT SDAKFRADGA SGPARVVSSG       300
     VETVIHRAIA PEVAPRLRIT SKTDLSYRYD TSSEDDSEAY SGIEDDYLSY QPSPNISDAA       360
     TFHGHRSRTG SPARAPHPLV EQEEHIELPV ISDDDSTSKS SVRDNYYSEE SDNTTSQALV       420
     TQDNSSHDTI HDTIRERSFD KSTSGSVTHS IPVIKDDNED WQNQLRQQSV HLGAWNPDTE       480
     GKRGAFLTQA SPMSTNKGMC GSQDEETTGD DQQLAEPCND DSDSVWEGFP SVGEYEDLQS       540
     VADIKTIYDN QTLYNVPGII TSSTSVPPLP SSMSELTSRQ DTSILSESTS GSGLDSDSLM       600
     RVVEGQRHAP KPSMFKENFG QTPEVQVEHL VNSPVPSLDI CALIEGPQSH SFKRDKLNSH       660
     IEDLNAYSSG AQTWIKYALK STQSSSNITF DEYVISKHVQ DAYAQAEEVS KKHSVTNAVN       720
     QNVSQLRKKV FSHSMKEGAK GLLSSIGKKK L                                      751
//

If you have problems or comments...

PBIL Back to PBIL home page