(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE244

ASHGO_3.PE244        Location/Qualifiers
FT   CDS             428007..430031
FT                   /codon_start=1
FT                   /gene_family="HOG000228135" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19774725"
FT                   /gene_name="KAR2"
FT                   /locus_tag="ACR038W"
FT                   /product="78 kDa glucose-regulated protein homolog "
FT                   /function="ATP binding"
FT                   /biological_process="response to stress"
FT                   /cellular_component="endoplasmic reticulum lumen "
FT                   /protein_id="AAS51265.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005788"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="HOGENOM:HBG334976"
FT                   /db_xref="HOGENOM:HBG396971"
FT                   /db_xref="InterPro:IPR001023"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniParc:UPI00002527F1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75C78"
FT                   /transl_table=1
FT                   /translation="MAFGKVSNWAVPLTALMYAMALVCLPMFAGGSRGLVYAADTDAEN
FT                   YGTVIGIDLGTTYSCVALMRNGKTEILANEQGNRITPSYVAFTDDERLIGDAAKNQVAN
FT                   NPKNTIFDIKRLIGLKYNDKTVQREIKHLPFEVVDKNGMPAVAVTVKGERKLFTPEEIS
FT                   GMVLGKMKQIAEEYLGKKVTHAVVTVPAYFNDAQRQATKDAGAIAGLNILRIVNEPTAA
FT                   AIAYGLDKTEDEHRIVVYDLGGGTFDVSLLSIENGVFEVQATAGDTHLGGEDFDYKLVR
FT                   HFLKVFKKKHGVDVSSNAKAMAKLKREAEKAKRALSSQMSTRVEIDSFVDGIDFSETLT
FT                   RAKFEEMNLDLFKRTLKPVEKVLQDAGLKKEDIDDIVLVGGSTRIPKVQELLENFFNKK
FT                   ASKGINPDEAVAYGAAVQAGVLSGEEGVEDIVLLDVNPLTLGIEVTGGIMTPLIKRNTP
FT                   IPTKKSQIFSTAVDNQKTVMIQVYEGERAMAKDNNHLGKFELSGIPPAPRGIPQIEVTF
FT                   ALDANGILKVSATDKGTGKSESVTITNEKGRLSKDDIERMVAEAENYQKEDEEIRAKVE
FT                   ARHKLENYAHSLKNQVNGDLGDKLEEDDKETLLEAANDVLEWLEDNSDSATKEEFNEKF
FT                   ESLSQTAYPITSKLYGAGASDATDDEDDESDDYFDHDEL"
     MAFGKVSNWA VPLTALMYAM ALVCLPMFAG GSRGLVYAAD TDAENYGTVI GIDLGTTYSC        60
     VALMRNGKTE ILANEQGNRI TPSYVAFTDD ERLIGDAAKN QVANNPKNTI FDIKRLIGLK       120
     YNDKTVQREI KHLPFEVVDK NGMPAVAVTV KGERKLFTPE EISGMVLGKM KQIAEEYLGK       180
     KVTHAVVTVP AYFNDAQRQA TKDAGAIAGL NILRIVNEPT AAAIAYGLDK TEDEHRIVVY       240
     DLGGGTFDVS LLSIENGVFE VQATAGDTHL GGEDFDYKLV RHFLKVFKKK HGVDVSSNAK       300
     AMAKLKREAE KAKRALSSQM STRVEIDSFV DGIDFSETLT RAKFEEMNLD LFKRTLKPVE       360
     KVLQDAGLKK EDIDDIVLVG GSTRIPKVQE LLENFFNKKA SKGINPDEAV AYGAAVQAGV       420
     LSGEEGVEDI VLLDVNPLTL GIEVTGGIMT PLIKRNTPIP TKKSQIFSTA VDNQKTVMIQ       480
     VYEGERAMAK DNNHLGKFEL SGIPPAPRGI PQIEVTFALD ANGILKVSAT DKGTGKSESV       540
     TITNEKGRLS KDDIERMVAE AENYQKEDEE IRAKVEARHK LENYAHSLKN QVNGDLGDKL       600
     EEDDKETLLE AANDVLEWLE DNSDSATKEE FNEKFESLSQ TAYPITSKLY GAGASDATDD       660
     EDDESDDYFD HDEL                                                         674
//

If you have problems or comments...

PBIL Back to PBIL home page