(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE276

ASHGO_3.PE276        Location/Qualifiers
FT   CDS             487566..488642
FT                   /codon_start=1
FT                   /gene_family="HOG000247199" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18927745"
FT                   /locus_tag="AGOS_ACR070W"
FT                   /product="ACR070Wp"
FT                   /function="ATP binding"
FT                   /function="homoserine kinase activity"
FT                   /biological_process="threonine metabolic process "
FT                   /protein_id="AAS51296.2"
FT                   /db_xref="GO:0004413"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006566"
FT                   /db_xref="HOGENOM:HBG123215"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI0001DB282E"
FT                   /db_xref="UniProtKB/TrEMBL:Q75C47"
FT                   /transl_table=1
FT                   /translation="MQRKFKIKVPASSANIGPGYDVLGIGLGLFLELSVSINSEQAQLT
FT                   NADPNNCHLEYTEDSEGYASVPLRSDENLITRTALYLLRCNNIRSFPAGTQIVVHNPIP
FT                   LGRGLGSSGAAVVAGALLGNEIGQLGFSKQRVLDFCLMIERHPDNITAALMGGFCGSFL
FT                   RDLTPAELERREIPLAEVLPGPRASGGEDTGMSPPEPPFNIGQHVKYNWNPAVKCLVVI
FT                   PNFELSTATSREVLPQAYTTKDLVFNLQRLAVLTTALSQNPPNPELIYPAMQDRVHQPY
FT                   RKTLIPGLSEILSSVTPTTHPGLLGICLSGAGPTILALATGNFEDIAGEIVARFSKWNV
FT                   TCTWKLLDIAEQGSAVEA"
     MQRKFKIKVP ASSANIGPGY DVLGIGLGLF LELSVSINSE QAQLTNADPN NCHLEYTEDS        60
     EGYASVPLRS DENLITRTAL YLLRCNNIRS FPAGTQIVVH NPIPLGRGLG SSGAAVVAGA       120
     LLGNEIGQLG FSKQRVLDFC LMIERHPDNI TAALMGGFCG SFLRDLTPAE LERREIPLAE       180
     VLPGPRASGG EDTGMSPPEP PFNIGQHVKY NWNPAVKCLV VIPNFELSTA TSREVLPQAY       240
     TTKDLVFNLQ RLAVLTTALS QNPPNPELIY PAMQDRVHQP YRKTLIPGLS EILSSVTPTT       300
     HPGLLGICLS GAGPTILALA TGNFEDIAGE IVARFSKWNV TCTWKLLDIA EQGSAVEA         358
//

If you have problems or comments...

PBIL Back to PBIL home page