(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE280

ASHGO_3.PE280        Location/Qualifiers
FT   CDS             496155..497387
FT                   /codon_start=1
FT                   /gene_family="HOG000192515" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15748970"
FT                   /gene_name="SNX4"
FT                   /gene_synonym="ATG24"
FT                   /locus_tag="ACR074W"
FT                   /product="Sorting nexin-4"
FT                   /function="phosphatidylinositol binding"
FT                   /biological_process="autophagy"
FT                   /biological_process="cell communication"
FT                   /biological_process="protein transport"
FT                   /cellular_component="endosome membrane"
FT                   /protein_id="AAS51300.1"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="GO:0007154"
FT                   /db_xref="GO:0010008"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0035091"
FT                   /db_xref="HOGENOM:HBG058403"
FT                   /db_xref="HOGENOM:HBG202212"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR015404"
FT                   /db_xref="UniParc:UPI0000252814"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75C43"
FT                   /transl_table=1
FT                   /translation="MSEIKLGDQWFIIVSDPQKQRGDKSSSGSYVTYQISSKPATEGDK
FT                   RSGEDDITVVHRRYSDFVLLYQILANDYPACIVPPLPDKKVLNYLDRFSQSFTQKRCHS
FT                   LQNFLQRLAQHPVLSQSKILHTFLVSSDWDAYQKSLAETVGNLSNKEELTETIMNAFKS
FT                   VHSQSDEFVEIKEKSGKLDHNVSKIDKLFHRVVKKQEAIAEDYGKLGLSLRELQELVTT
FT                   GDDRNSEVGNLGTKIKTFNEGMAQLSYSLRDLSRYIDYEYIIDLRDMEDYIDSMKQLIK
FT                   LKDQKQIDYEELSDYLTRSINEKNNLISGYGSGSNFFKSKLEEFTGINQEAARREKISK
FT                   LESKVQALTTEVENAKKVADAFEKEALKEVEIFEQIKTRELKRSLTTLADHHIEFYQKM
FT                   VNTWSKIEESL"
     MSEIKLGDQW FIIVSDPQKQ RGDKSSSGSY VTYQISSKPA TEGDKRSGED DITVVHRRYS        60
     DFVLLYQILA NDYPACIVPP LPDKKVLNYL DRFSQSFTQK RCHSLQNFLQ RLAQHPVLSQ       120
     SKILHTFLVS SDWDAYQKSL AETVGNLSNK EELTETIMNA FKSVHSQSDE FVEIKEKSGK       180
     LDHNVSKIDK LFHRVVKKQE AIAEDYGKLG LSLRELQELV TTGDDRNSEV GNLGTKIKTF       240
     NEGMAQLSYS LRDLSRYIDY EYIIDLRDME DYIDSMKQLI KLKDQKQIDY EELSDYLTRS       300
     INEKNNLISG YGSGSNFFKS KLEEFTGINQ EAARREKISK LESKVQALTT EVENAKKVAD       360
     AFEKEALKEV EIFEQIKTRE LKRSLTTLAD HHIEFYQKMV NTWSKIEESL                  410
//

If you have problems or comments...

PBIL Back to PBIL home page