(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE284

ASHGO_3.PE284        Location/Qualifiers
FT   CDS             join(501162..501168,501253..502646)
FT                   /codon_start=1
FT                   /gene_family="HOG000268797" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20622173"
FT                   /gene_name="DBP5"
FT                   /locus_tag="ACR078W"
FT                   /product="ATP-dependent RNA helicase DBP5 "
FT                   /EC_number="3.6.4.13"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="RNA binding"
FT                   /biological_process="mRNA transport"
FT                   /biological_process="protein transport"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nuclear membrane"
FT                   /cellular_component="nuclear pore"
FT                   /protein_id="AAS51304.2"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005643"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0031965"
FT                   /db_xref="GO:0051028"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG517301"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI0001DB2831"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75C39"
FT                   /transl_table=1
FT                   /translation="MSGNAQKPDASEMLADLDLNKKTKETTLEAGSAESAPSAPAENQA
FT                   KSDSNLINSEYEVKVRLADIQADPNSPLYSVKSFEELGLAPELLKGLYAMKFQKPSKIQ
FT                   ERALPLLLHNPPRNMIAQSQSGTGKTAAFSLTMLSRVDVAVPATQAICLAPSRELARQT
FT                   LEVIQEMGKFTKIASQLIVPDSYEKNKAINAHIIVGTPGTVLDLMRRKMIQLGKVKTFV
FT                   LDEADNMLDKQGLGDQCIRVKKFLPKDTQLVLFSATFDDSVREYARRVVPNANSLELQR
FT                   NEVNVSAIKQLFMDCNDERHKFTVLCDLYGLLTIGSSIIFVQTKQTANMLYTELKREGH
FT                   QVSILHGDLQSADRDRLIGDFREGRSKVLITTNVLARGIDIPTVSMVVNYDLPMTANGQ
FT                   PDPSTYVHRIGRTGRFGRTGVAISFIHDKKSYETLAAIQSYFGDIQITKVPTDDMDEME
FT                   KIVKKVLK"
     MSGNAQKPDA SEMLADLDLN KKTKETTLEA GSAESAPSAP AENQAKSDSN LINSEYEVKV        60
     RLADIQADPN SPLYSVKSFE ELGLAPELLK GLYAMKFQKP SKIQERALPL LLHNPPRNMI       120
     AQSQSGTGKT AAFSLTMLSR VDVAVPATQA ICLAPSRELA RQTLEVIQEM GKFTKIASQL       180
     IVPDSYEKNK AINAHIIVGT PGTVLDLMRR KMIQLGKVKT FVLDEADNML DKQGLGDQCI       240
     RVKKFLPKDT QLVLFSATFD DSVREYARRV VPNANSLELQ RNEVNVSAIK QLFMDCNDER       300
     HKFTVLCDLY GLLTIGSSII FVQTKQTANM LYTELKREGH QVSILHGDLQ SADRDRLIGD       360
     FREGRSKVLI TTNVLARGID IPTVSMVVNY DLPMTANGQP DPSTYVHRIG RTGRFGRTGV       420
     AISFIHDKKS YETLAAIQSY FGDIQITKVP TDDMDEMEKI VKKVLK                      466
//

If you have problems or comments...

PBIL Back to PBIL home page