(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE293

ASHGO_3.PE293        Location/Qualifiers
FT   CDS             complement(514604..515377)
FT                   /codon_start=1
FT                   /gene_family="HOG000039270" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19774733"
FT                   /locus_tag="ACR087C"
FT                   /orf_name="AGOS_ACR087C"
FT                   /product="ACR087Cp"
FT                   /function="protein kinase regulator activity"
FT                   /cellular_component="protein kinase CK2 complex "
FT                   /protein_id="AAS51313.1"
FT                   /db_xref="GO:0005956"
FT                   /db_xref="GO:0019887"
FT                   /db_xref="HOGENOM:HBG211728"
FT                   /db_xref="HOGENOM:HBG736305"
FT                   /db_xref="HSSP:1JWH"
FT                   /db_xref="InterPro:IPR000704"
FT                   /db_xref="InterPro:IPR016149"
FT                   /db_xref="InterPro:IPR016150"
FT                   /db_xref="UniParc:UPI0000252821"
FT                   /db_xref="UniProtKB/TrEMBL:Q75C30"
FT                   /transl_table=1
FT                   /translation="MSERRLEEHGTAETADVEMADAVETNSTGSSDYVELWIDLFLGKK
FT                   GHEYFCDVDTEYITDRFNLINLQKTVSKFTQVIQYMVDELDDTTLEAMSRTKLTQLEAD
FT                   ARKLYGLIHARYIITIKGLQKMLQKYRDADFCRCPRVHCNFQPLLPVGLHDVPGIDCVK
FT                   LYCPSCEDLYIPKSSRHSSIDGAYFGTSFPGMFLQAFPEVVPKHPTKRYVPKVFGFDLH
FT                   KQAQLARWQELQRLKLERELIKKGVDLTKNGGYKK"
     MSERRLEEHG TAETADVEMA DAVETNSTGS SDYVELWIDL FLGKKGHEYF CDVDTEYITD        60
     RFNLINLQKT VSKFTQVIQY MVDELDDTTL EAMSRTKLTQ LEADARKLYG LIHARYIITI       120
     KGLQKMLQKY RDADFCRCPR VHCNFQPLLP VGLHDVPGID CVKLYCPSCE DLYIPKSSRH       180
     SSIDGAYFGT SFPGMFLQAF PEVVPKHPTK RYVPKVFGFD LHKQAQLARW QELQRLKLER       240
     ELIKKGVDLT KNGGYKK                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page