(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE294

ASHGO_3.PE294        Location/Qualifiers
FT   CDS             515563..518115
FT                   /codon_start=1
FT                   /gene_family="HOG000112901" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18927747"
FT                   /gene_name="HIR2"
FT                   /locus_tag="ACR088W"
FT                   /product="Protein HIR2"
FT                   /function="transcription regulator activity"
FT                   /biological_process="chromatin modification"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS51314.2"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG058409"
FT                   /db_xref="HOGENOM:HBG202815"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR011494"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI0001DB2833"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75C29"
FT                   /transl_table=1
FT                   /translation="MKLLKYPRQLHDGQLLAGCVVGGLLVVVGRDRISAYDCGKLQAAA
FT                   RGELAVREVSAEVELQVEVGEDALRYVAGGEGELVVAGDRQIWAAGADWRSAGRGTRFL
FT                   TVAQLAGGACVTDVKADGAGLVFVSVSGKDEVWLYATGAWERVGVVTLAAKPVTLVVDP
FT                   LGELLTVVLQNRSVAVYQYNRQGAVRMHQQLPQYVQTNPLRYSITMSPQGDLLPLVNSI
FT                   KNGLPSAQLLDRTAGFSVQSTLVGYVDKCKILRFSPRLYEKPNKDKPPTQYNLLASSGN
FT                   EDGSVIVWNTKRTKPLLNAAKVTDTFINDVQWSRDGTGLFAISNDGYLFIFAFHEVELG
FT                   RLLDDAELEKLRQSVPRLEPLPPPTPKSLAKSEAKPQQDTKPDAKSSANSVSAKTGKKK
FT                   IAPTVITSTSMEFNEPSYTVPKDLKRRPKQETQTNGTTTKRPKRDVEPMDFLDTNLLIP
FT                   NISFSKARLATPKVRMNFQYCNTLQQNLVMEVKNGTGSEQKPTSITLTLKDKEKDMVLF
FT                   QDFTPRFVTICTCGHSFWACCTEEGIVYVYSNTGKKLLPPMIMGVPVSFLEGCGDYLLC
FT                   VTSMGQLFCWNVKEGKLKFPVNTIYPLLNPSIRYSDDVLTRAENITMCTTTENGIPLVT
FT                   LSNGDGYMFDPDMEIWLLINDSWWAYGSQYWDFTNTSHAGSSAAAGNDKEDKKNKYWNA
FT                   DAEYLIEEVKKNKKSVVNYLESKTNDEMTRKGLIRNLQRFAKTILMKEGFENLEDIVTL
FT                   SHLENRLLVALKLNETNEFTKLLKVYCISLAEMGFKNRLDDVLSWLYNDGEYKVGTIAN
FT                   EKREELLKQILVACADIRQVQRVTTSYASALGLLDVSL"
     MKLLKYPRQL HDGQLLAGCV VGGLLVVVGR DRISAYDCGK LQAAARGELA VREVSAEVEL        60
     QVEVGEDALR YVAGGEGELV VAGDRQIWAA GADWRSAGRG TRFLTVAQLA GGACVTDVKA       120
     DGAGLVFVSV SGKDEVWLYA TGAWERVGVV TLAAKPVTLV VDPLGELLTV VLQNRSVAVY       180
     QYNRQGAVRM HQQLPQYVQT NPLRYSITMS PQGDLLPLVN SIKNGLPSAQ LLDRTAGFSV       240
     QSTLVGYVDK CKILRFSPRL YEKPNKDKPP TQYNLLASSG NEDGSVIVWN TKRTKPLLNA       300
     AKVTDTFIND VQWSRDGTGL FAISNDGYLF IFAFHEVELG RLLDDAELEK LRQSVPRLEP       360
     LPPPTPKSLA KSEAKPQQDT KPDAKSSANS VSAKTGKKKI APTVITSTSM EFNEPSYTVP       420
     KDLKRRPKQE TQTNGTTTKR PKRDVEPMDF LDTNLLIPNI SFSKARLATP KVRMNFQYCN       480
     TLQQNLVMEV KNGTGSEQKP TSITLTLKDK EKDMVLFQDF TPRFVTICTC GHSFWACCTE       540
     EGIVYVYSNT GKKLLPPMIM GVPVSFLEGC GDYLLCVTSM GQLFCWNVKE GKLKFPVNTI       600
     YPLLNPSIRY SDDVLTRAEN ITMCTTTENG IPLVTLSNGD GYMFDPDMEI WLLINDSWWA       660
     YGSQYWDFTN TSHAGSSAAA GNDKEDKKNK YWNADAEYLI EEVKKNKKSV VNYLESKTND       720
     EMTRKGLIRN LQRFAKTILM KEGFENLEDI VTLSHLENRL LVALKLNETN EFTKLLKVYC       780
     ISLAEMGFKN RLDDVLSWLY NDGEYKVGTI ANEKREELLK QILVACADIR QVQRVTTSYA       840
     SALGLLDVSL                                                              850
//

If you have problems or comments...

PBIL Back to PBIL home page