(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE297

ASHGO_3.PE297        Location/Qualifiers
FT   CDS             520608..521594
FT                   /codon_start=1
FT                   /gene_family="HOG000208901" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19774734"
FT                   /gene_name="CIA1"
FT                   /locus_tag="ACR091W"
FT                   /product="Probable cytosolic iron-sulfur protein assembly
FT                   protein 1"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS51317.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG051997"
FT                   /db_xref="HOGENOM:HBG520580"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI0000252825"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75C26"
FT                   /transl_table=1
FT                   /translation="MPNLHLVRSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRNFK
FT                   LVEELDDTAHKKAVRSVAWRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHE
FT                   NEVKSVAWSHDGAYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRL
FT                   LLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRI
FT                   WRCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSADGLIASVGSDGVLAVYKEVQAGR
FT                   WEVVARVDCAHTVYEINVVKWLALDGRVLLVTGGDDGCVNVWELREE"
     MPNLHLVRSL KLHGDRCWSV DISKGLLATG SADRKIKLVD VRNFKLVEEL DDTAHKKAVR        60
     SVAWRPHCNV LAAGSFDTTV SIWGRDDDDY SGETELLAVI EGHENEVKSV AWSHDGAYLA       120
     TCSRDKSVWI WEADELSEEF ECNSVLQEHS QDVKHIVWHA SRLLLASSSY DDTVRIWAEQ       180
     DDDWECAAVL SGHGGTVWCS DFERAETGIR LCSGSDDTTV RIWRCLTDDA DVFDKEWIQE       240
     TVLPAVHTRA VYSVSWSADG LIASVGSDGV LAVYKEVQAG RWEVVARVDC AHTVYEINVV       300
     KWLALDGRVL LVTGGDDGCV NVWELREE                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page