(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE299

ASHGO_3.PE299        Location/Qualifiers
FT   CDS             join(complement(523606..523709),complement(522624..523554))
FT                   /codon_start=1
FT                   /gene_family="HOG000066110" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19774736"
FT                   /gene_name="BIG1"
FT                   /locus_tag="ACR093C"
FT                   /product="Protein BIG1"
FT                   /biological_process="cellular cell wall organization "
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS51319.2"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0007047"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG058410"
FT                   /db_xref="HOGENOM:HBG203773"
FT                   /db_xref="UniParc:UPI0001DB2835"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75C24"
FT                   /transl_table=1
FT                   /translation="MQNVASWLLALVVAVVQGELLPGKSAPALLWSYKLSEGIQEYQLA
FT                   YNMTTVLPAPEFNAIALELLDHCNSHAYVFVNQPGLRLEDFDYEDAWTVLPNYLSRSSS
FT                   ALRFEQVEVSPSNVFENLIAHTKRRCDVQREIILRAEQTNQFEPYIDAQSRIIQVHFSP
FT                   LPGDGRNERPSREDVLADHDQRLRRILGRLPSPAVTVIYTSLEPADRLSASPPRAGIFP
FT                   EIFEHESRRIEYERNDRDLQVNRYFPSHHPKMEPIEEVELSLLDPKFIQSNLKLLKLIA
FT                   VSAIGSLTWQLYSLFSPKLPVATPKGTAKRQKGQKKLVKLATAQAAKQAEEVKLEVSQQ
FT                   EKED"
     MQNVASWLLA LVVAVVQGEL LPGKSAPALL WSYKLSEGIQ EYQLAYNMTT VLPAPEFNAI        60
     ALELLDHCNS HAYVFVNQPG LRLEDFDYED AWTVLPNYLS RSSSALRFEQ VEVSPSNVFE       120
     NLIAHTKRRC DVQREIILRA EQTNQFEPYI DAQSRIIQVH FSPLPGDGRN ERPSREDVLA       180
     DHDQRLRRIL GRLPSPAVTV IYTSLEPADR LSASPPRAGI FPEIFEHESR RIEYERNDRD       240
     LQVNRYFPSH HPKMEPIEEV ELSLLDPKFI QSNLKLLKLI AVSAIGSLTW QLYSLFSPKL       300
     PVATPKGTAK RQKGQKKLVK LATAQAAKQA EEVKLEVSQQ EKED                        344
//

If you have problems or comments...

PBIL Back to PBIL home page