(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE306

ASHGO_3.PE306        Location/Qualifiers
FT   CDS             complement(533261..533812)
FT                   /codon_start=1
FT                   /gene_family="HOG000015154" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15748981"
FT                   /gene_name="AIM41"
FT                   /locus_tag="ACR100C"
FT                   /product="Altered inheritance of mitochondria protein 41,
FT                   mitochondrial"
FT                   /function="carbon-nitrogen ligase activity, with glutamine
FT                   as amido-N-donor"
FT                   /biological_process="translation"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="AAS51326.1"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0016884"
FT                   /db_xref="HOGENOM:HBG076098"
FT                   /db_xref="HOGENOM:HBG672872"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="UniParc:UPI000025282E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75C17"
FT                   /transl_table=1
FT                   /translation="MLMNSAARPMLLFRALARRSASSQAYTDALAHLKQDLKKAMLAKD
FT                   DTKKTTIRSLLATIKNKEIDSRDKPLDHFALHDIYSKLVAQRRESIDGFLKNGRDDLVQ
FT                   KEQLEMQLIQAYMAALPVASAEELAARADAFLHELKSTHGALPLPKVFAQVSWPTVAQD
FT                   WNASPAAVRSALAAAFKKSS"
     MLMNSAARPM LLFRALARRS ASSQAYTDAL AHLKQDLKKA MLAKDDTKKT TIRSLLATIK        60
     NKEIDSRDKP LDHFALHDIY SKLVAQRRES IDGFLKNGRD DLVQKEQLEM QLIQAYMAAL       120
     PVASAEELAA RADAFLHELK STHGALPLPK VFAQVSWPTV AQDWNASPAA VRSALAAAFK       180
     KSS                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page