(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE313

ASHGO_3.PE313        Location/Qualifiers
FT   CDS             544400..545554
FT                   /codon_start=1
FT                   /gene_family="HOG000164620" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622175"
FT                   /locus_tag="AGOS_ACR107W"
FT                   /product="ACR107Wp"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS51333.2"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058418"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0001DB2848"
FT                   /db_xref="UniProtKB/TrEMBL:Q75C10"
FT                   /transl_table=1
FT                   /translation="MSTENVQTDYASTKKRKKVVKACVFCRRSHMICDDRRPCSRCIKR
FT                   DIGHLCCDEKLQPGAERLQSQSPLRTETFDVQPVPEHLVAGLGVGAAGGNRYANVINHP
FT                   KFVSEHIGSEFSSLNEFLTLLEDPLLMEATPSPGCNGQAADPGARGPGELVGGVLAGAA
FT                   PQEQPTAKENFFLTAADPSTEVEPEDRLKLVINAKLEAGLLQPYNYSQGYARLQNYMDK
FT                   YMNQSSRQRILKPLSTIRPAFRAIARSLKDVDLVLVEEGFERMLLSYDRVFTSMSMPAC
FT                   LWRRTGEIYRGNKEFASLVDCTVDDLRDGNLAIYELMTEESAVNFWEKYGSIAFDKGQK
FT                   AVLTSCNLRSKDGRKRRPCCFSFTIRRDRYNIPICIIGNFIPIS"
     MSTENVQTDY ASTKKRKKVV KACVFCRRSH MICDDRRPCS RCIKRDIGHL CCDEKLQPGA        60
     ERLQSQSPLR TETFDVQPVP EHLVAGLGVG AAGGNRYANV INHPKFVSEH IGSEFSSLNE       120
     FLTLLEDPLL MEATPSPGCN GQAADPGARG PGELVGGVLA GAAPQEQPTA KENFFLTAAD       180
     PSTEVEPEDR LKLVINAKLE AGLLQPYNYS QGYARLQNYM DKYMNQSSRQ RILKPLSTIR       240
     PAFRAIARSL KDVDLVLVEE GFERMLLSYD RVFTSMSMPA CLWRRTGEIY RGNKEFASLV       300
     DCTVDDLRDG NLAIYELMTE ESAVNFWEKY GSIAFDKGQK AVLTSCNLRS KDGRKRRPCC       360
     FSFTIRRDRY NIPICIIGNF IPIS                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page