(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE32

ASHGO_3.PE32         Location/Qualifiers
FT   CDS             54838..56790
FT                   /codon_start=1
FT                   /gene_family="HOG000044189" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20621886"
FT                   /locus_tag="AGOS_ACL174W"
FT                   /product="ACL174Wp"
FT                   /function="catalytic activity"
FT                   /protein_id="AAS51054.2"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG058423"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI0001DB270E"
FT                   /db_xref="UniProtKB/TrEMBL:Q75CU3"
FT                   /transl_table=1
FT                   /translation="MAQQLLKQVLRTLALPVIMPLLALNRRFRILDDIRTITYFVQALV
FT                   AYGWCTLTQRFPTWYVFEAQVAKHGDSPCIRYCRPQARKGDFTVETYTYRETYEHVLRL
FT                   SYVLYHDYGVRAGEHVAVNYANKPMFLFLWLALWNIGAVPAFVNHNQKGTPLIHSVKIS
FT                   NARLLFVDAGTTNLPKGSEAELLKELPELQIHHFDEEQMLAIIKSDKSPSLLIKRGERT
FT                   PRTLHDYDPAMLIYTSGTTGLPKSAIMSWRKATLGCSLFGFMMRISPESVVLTAMPLYH
FT                   STAALLGVCAVFTQGGCIAISNKFSTTTFWKEAYLSKATHIQYVGEVCRYLMNAPKSEY
FT                   EDMATVKVAYGNGLRQSIWMDFKKRFRIEAIGEFYASTEAPFATTAFQLGTFGVGACRS
FT                   YGSLVHWILSYQQTLVRVDPDDESVVYRNENGFCEVPASDEPGELLMRIFFPRKPHTSF
FT                   QGYLGNKKATESKVLRDVFRKGDAWYRSGDLLKSDKYGQWYFVDRMGDTYRWKSENVST
FT                   TEVENQLLSFNKDLFDCLVVVGLKIPSYEGRAGFAVIQLNPARRGLDHASLLDDLVEYL
FT                   KHALPRYALPLFIKFTNQLETTDNYKFAKKQYKNQQLPHGADGDETIYWLKDYSQYKVL
FT                   TDEDWEQISTGKAKL"
     MAQQLLKQVL RTLALPVIMP LLALNRRFRI LDDIRTITYF VQALVAYGWC TLTQRFPTWY        60
     VFEAQVAKHG DSPCIRYCRP QARKGDFTVE TYTYRETYEH VLRLSYVLYH DYGVRAGEHV       120
     AVNYANKPMF LFLWLALWNI GAVPAFVNHN QKGTPLIHSV KISNARLLFV DAGTTNLPKG       180
     SEAELLKELP ELQIHHFDEE QMLAIIKSDK SPSLLIKRGE RTPRTLHDYD PAMLIYTSGT       240
     TGLPKSAIMS WRKATLGCSL FGFMMRISPE SVVLTAMPLY HSTAALLGVC AVFTQGGCIA       300
     ISNKFSTTTF WKEAYLSKAT HIQYVGEVCR YLMNAPKSEY EDMATVKVAY GNGLRQSIWM       360
     DFKKRFRIEA IGEFYASTEA PFATTAFQLG TFGVGACRSY GSLVHWILSY QQTLVRVDPD       420
     DESVVYRNEN GFCEVPASDE PGELLMRIFF PRKPHTSFQG YLGNKKATES KVLRDVFRKG       480
     DAWYRSGDLL KSDKYGQWYF VDRMGDTYRW KSENVSTTEV ENQLLSFNKD LFDCLVVVGL       540
     KIPSYEGRAG FAVIQLNPAR RGLDHASLLD DLVEYLKHAL PRYALPLFIK FTNQLETTDN       600
     YKFAKKQYKN QQLPHGADGD ETIYWLKDYS QYKVLTDEDW EQISTGKAKL                  650
//

If you have problems or comments...

PBIL Back to PBIL home page