(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE324

ASHGO_3.PE324        Location/Qualifiers
FT   CDS             559468..560106
FT                   /codon_start=1
FT                   /gene_family="HOG000252083" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15748992"
FT                   /gene_name="mge1"
FT                   /locus_tag="ACR118W"
FT                   /product="GrpE protein homolog, mitochondrial "
FT                   /function="adenyl-nucleotide exchange factor activity "
FT                   /function="chaperone binding"
FT                   /function="protein homodimerization activity"
FT                   /biological_process="protein folding"
FT                   /biological_process="protein import into mitochondrial
FT                   matrix"
FT                   /cellular_component="mitochondrial matrix"
FT                   /protein_id="AAS51344.1"
FT                   /db_xref="GO:0000774"
FT                   /db_xref="GO:0005759"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0030150"
FT                   /db_xref="GO:0042803"
FT                   /db_xref="GO:0051087"
FT                   /db_xref="HOGENOM:HBG447395"
FT                   /db_xref="HOGENOM:HBG732630"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniParc:UPI0000252840"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75C01"
FT                   /transl_table=1
FT                   /translation="MGPYLPAILRPIGRYATLYNVPRVAGQLRCYAADAKDAADAQGES
FT                   AADPRVAELEKQLADKSKEAADLKDRLLRSVADFRNLQEVTRRDVQKARDFALQRFSKD
FT                   LLESLDNFGHALGAVSPEALQRSPEIADLHAGVRLTRDVFEKTLLKHGIAPIDALGQPF
FT                   DPNLHEATFELPQPDKTPGTVFHVQQPGYTLNGRVIRPAKVGVVKDPDA"
     MGPYLPAILR PIGRYATLYN VPRVAGQLRC YAADAKDAAD AQGESAADPR VAELEKQLAD        60
     KSKEAADLKD RLLRSVADFR NLQEVTRRDV QKARDFALQR FSKDLLESLD NFGHALGAVS       120
     PEALQRSPEI ADLHAGVRLT RDVFEKTLLK HGIAPIDALG QPFDPNLHEA TFELPQPDKT       180
     PGTVFHVQQP GYTLNGRVIR PAKVGVVKDP DA                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page