(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE325

ASHGO_3.PE325        Location/Qualifiers
FT   CDS             560758..563553
FT                   /codon_start=1
FT                   /gene_family="HOG000247883" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15748993"
FT                   /locus_tag="AGOS_ACR119W"
FT                   /product="ACR119Wp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS51345.2"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG058425"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020674"
FT                   /db_xref="UniParc:UPI0001DB284C"
FT                   /db_xref="UniProtKB/TrEMBL:Q75C00"
FT                   /transl_table=1
FT                   /translation="MTSIPHRHTYYGGGATPPAATGPLSGSRGHAAGRSKKKQVTFGPY
FT                   IIGPTLGEGEFGKVKLGWSKARLDGDSRNVAIKLIRRDTVPKNSEKEIKIYRELNALKL
FT                   LSHPNIVRLEEVLQNSKYIGIVLQYASGGEFYKYIQKKRRLKEPPACRLFAQLISGVHY
FT                   IHYKGLAHRDLKLENLLLDEHENLIITDFGFVNEFHKNDLMRTSCGSPCYAAPELVVSS
FT                   KPYSAQKADVWSCGVILYAMLAGYLPWDDDPENPEGDDIAKLYQYITHTSLKFPEYIKP
FT                   IPRDLLRRILVSNPEVRLTVADIEQHAWLQPHAQFLMWSPSDWDAKAKAETNNLFRQPS
FT                   AVHAGVLRPQSSCSISSANSKGDNRGSLIMDSTLNPQPVPPQEFQSHIIMKPTSPSNGL
FT                   RKMSPVRRHARSNSAASIALQAVVDAERDYFNSPSIHSLHHDSLSQNTTPPSSAGRVPT
FT                   YAITRSATHHNGISSSLMNRNSVIIEVSPQKGSVPPVMIPGNRESLNGQESGGIAMADM
FT                   SQRPTIVKDKTSSHMVPQAGRKQRPTSYQPCSTTAFAQSPDLVSGAGALVPIMGKQQRV
FT                   STASNPTFVDVGRSGSTRRLPGPNNQLLETPFEADRQIDDNPVVDDATIKSDDMLPSTL
FT                   EIVAYDNECGTSPGSNGQHRRYSAIVMSEIYEQEEGERISCELSSPKKMGSARPDCSTA
FT                   RISINTPNMGLQNRECIVSSSSPESDASSKQKSGKTDKKDKRFSLLSFYSFYNNSKSSI
FT                   DSSTDAVQPTGLVLDVVKHPNISRTSSQKKNPAPAGNGTQAIPRRHNTLPREAQRTPVA
FT                   LSYVYASLDVTPNAGTPELADVPSPINLVKMAEQPHGTKQHDPSTPTRSATVHGKSQRL
FT                   SNNTPKGPIYEDPKPKRKTNKVSLMVSSINPSQAPQPPRQKEPSTARKVLDFFKRRSLR
FT                   I"
     MTSIPHRHTY YGGGATPPAA TGPLSGSRGH AAGRSKKKQV TFGPYIIGPT LGEGEFGKVK        60
     LGWSKARLDG DSRNVAIKLI RRDTVPKNSE KEIKIYRELN ALKLLSHPNI VRLEEVLQNS       120
     KYIGIVLQYA SGGEFYKYIQ KKRRLKEPPA CRLFAQLISG VHYIHYKGLA HRDLKLENLL       180
     LDEHENLIIT DFGFVNEFHK NDLMRTSCGS PCYAAPELVV SSKPYSAQKA DVWSCGVILY       240
     AMLAGYLPWD DDPENPEGDD IAKLYQYITH TSLKFPEYIK PIPRDLLRRI LVSNPEVRLT       300
     VADIEQHAWL QPHAQFLMWS PSDWDAKAKA ETNNLFRQPS AVHAGVLRPQ SSCSISSANS       360
     KGDNRGSLIM DSTLNPQPVP PQEFQSHIIM KPTSPSNGLR KMSPVRRHAR SNSAASIALQ       420
     AVVDAERDYF NSPSIHSLHH DSLSQNTTPP SSAGRVPTYA ITRSATHHNG ISSSLMNRNS       480
     VIIEVSPQKG SVPPVMIPGN RESLNGQESG GIAMADMSQR PTIVKDKTSS HMVPQAGRKQ       540
     RPTSYQPCST TAFAQSPDLV SGAGALVPIM GKQQRVSTAS NPTFVDVGRS GSTRRLPGPN       600
     NQLLETPFEA DRQIDDNPVV DDATIKSDDM LPSTLEIVAY DNECGTSPGS NGQHRRYSAI       660
     VMSEIYEQEE GERISCELSS PKKMGSARPD CSTARISINT PNMGLQNREC IVSSSSPESD       720
     ASSKQKSGKT DKKDKRFSLL SFYSFYNNSK SSIDSSTDAV QPTGLVLDVV KHPNISRTSS       780
     QKKNPAPAGN GTQAIPRRHN TLPREAQRTP VALSYVYASL DVTPNAGTPE LADVPSPINL       840
     VKMAEQPHGT KQHDPSTPTR SATVHGKSQR LSNNTPKGPI YEDPKPKRKT NKVSLMVSSI       900
     NPSQAPQPPR QKEPSTARKV LDFFKRRSLR I                                      931
//

If you have problems or comments...

PBIL Back to PBIL home page