(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE344

ASHGO_3.PE344        Location/Qualifiers
FT   CDS             complement(592864..593943)
FT                   /codon_start=1
FT                   /gene_family="HOG000205736" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15749001"
FT                   /gene_name="RRD2"
FT                   /locus_tag="ACR139C"
FT                   /product="Serine/threonine-protein phosphatase 2A activator
FT                   2"
FT                   /EC_number="5.2.1.8"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /function="phosphatase activator activity"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS51365.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0019211"
FT                   /db_xref="HOGENOM:HBG191557"
FT                   /db_xref="HOGENOM:HBG526297"
FT                   /db_xref="InterPro:IPR004327"
FT                   /db_xref="UniParc:UPI0000252855"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75BY1"
FT                   /transl_table=1
FT                   /translation="MSDGAELKMAAQKRLLTGSDLDKWKASKTFEELLRFVSSLAQSVR
FT                   GRENSEHAEPVSPAIEALEALLEEMQGIAAHHPVLQDAATSRFGKVEFRDFHKEVQARA
FT                   EALVLQVDPSLTDEQAQELAVYLGNAWGDCKRIDYGSGHELNFVCFLYGLWKYGVLSEH
FT                   DFTNAVLRVFVKYMDVMRVLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLATHKHLK
FT                   PKSIHNPEVVELFENRYLYFGCIAFINRVKTTASLRWHSPMLDDISGVRSWTKVSEGMV
FT                   KMYKAEVLGKLPIMQHFFFSRFLPVPDGVSPPRTSEEELADCSEHAHSTWGDCCGIPIP
FT                   SAVAASEATRKHSKPLPFD"
     MSDGAELKMA AQKRLLTGSD LDKWKASKTF EELLRFVSSL AQSVRGRENS EHAEPVSPAI        60
     EALEALLEEM QGIAAHHPVL QDAATSRFGK VEFRDFHKEV QARAEALVLQ VDPSLTDEQA       120
     QELAVYLGNA WGDCKRIDYG SGHELNFVCF LYGLWKYGVL SEHDFTNAVL RVFVKYMDVM       180
     RVLETKYWLE PAGSHGVWGL DDYHFLPFLF GAFQLATHKH LKPKSIHNPE VVELFENRYL       240
     YFGCIAFINR VKTTASLRWH SPMLDDISGV RSWTKVSEGM VKMYKAEVLG KLPIMQHFFF       300
     SRFLPVPDGV SPPRTSEEEL ADCSEHAHST WGDCCGIPIP SAVAASEATR KHSKPLPFD        359
//

If you have problems or comments...

PBIL Back to PBIL home page