(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE347

ASHGO_3.PE347        Location/Qualifiers
FT   CDS             597519..600062
FT                   /codon_start=1
FT                   /gene_family="HOG000074515" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622182"
FT                   /locus_tag="AGOS_ACR142W"
FT                   /product="ACR142Wp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS51368.2"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG058433"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016256"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020648"
FT                   /db_xref="UniParc:UPI0001DB2865"
FT                   /db_xref="UniProtKB/TrEMBL:Q75CE9"
FT                   /transl_table=1
FT                   /translation="MFHACGSSAARGLVAYLGSEYLRRNVDMDYITQPTQQGTQATQKY
FT                   VIEKFSQERIDDDVVCRVICTSGQLKIQDLKVDVREVVKKKEAIKQVWLFGRNRQSCDY
FT                   HLGDISRLSNKHFQIMLGEDGNLLLKDLSTNGTWLNDVRIEKGQNMILGQGDEITVGKG
FT                   VQQDVVNIVVFLNDNFQKKLETARLEGLRKPAKHTTLRTQSPRAPLTGIFKDFSINDEV
FT                   VGQGAFATVKKAVERNTGKTFAVKIINKRKVMGNVDGVTRELEVLRRLNHPRIVSLKGF
FT                   YEDDESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAVRYIHEQGISHRDLK
FT                   PDNILIEQDDPVLVKITDFGLAKIQDNTTFMKTFCGTLAYVAPEVIGGKNPEGNGANGN
FT                   LYSSLVDMWSIGCLVYVILTGHLPFSGSTQEQLYKQIANGSYHEGPLKDYRISDEARDF
FT                   IDSLLQINPVDRLTAERALQHPWLHPCTSIGAEIAVSLSQSLSQARALEGMDEAEYLVA
FT                   QSEVASNRKAPTHEKRVILADHIAEENVGFRMPVHPPVRYTQKAQPVLGLEQDTRTHEE
FT                   PVETHNERQLEDNTALLEGSVDSHTTYSTSNMQQKRKPTRAADGLFLTLHPLANSSVRK
FT                   RIYVNQGINPFFIGRSDECHYKIPDNRLSRIHCFFLKKRHPVGNSIYESPAQGLDDIWY
FT                   CHNGTNVSYVNDMKLLPGTKVLLQDGDQVKVIWDKAQNITIAFRVEINDSAGLFNSAAV
FT                   TQNARHISQQTPDELALAVSFIELMRTQMHAIHNSETPPADTGSCSAVAAGNDAAASSI
FT                   LRKIHYSTLSQVPMKKAKRAKLAQADRNEDSLQFL"
     MFHACGSSAA RGLVAYLGSE YLRRNVDMDY ITQPTQQGTQ ATQKYVIEKF SQERIDDDVV        60
     CRVICTSGQL KIQDLKVDVR EVVKKKEAIK QVWLFGRNRQ SCDYHLGDIS RLSNKHFQIM       120
     LGEDGNLLLK DLSTNGTWLN DVRIEKGQNM ILGQGDEITV GKGVQQDVVN IVVFLNDNFQ       180
     KKLETARLEG LRKPAKHTTL RTQSPRAPLT GIFKDFSIND EVVGQGAFAT VKKAVERNTG       240
     KTFAVKIINK RKVMGNVDGV TRELEVLRRL NHPRIVSLKG FYEDDESYYL LMEFVSGGDL       300
     MDFVAAHGSV GEDAGREITR QILEAVRYIH EQGISHRDLK PDNILIEQDD PVLVKITDFG       360
     LAKIQDNTTF MKTFCGTLAY VAPEVIGGKN PEGNGANGNL YSSLVDMWSI GCLVYVILTG       420
     HLPFSGSTQE QLYKQIANGS YHEGPLKDYR ISDEARDFID SLLQINPVDR LTAERALQHP       480
     WLHPCTSIGA EIAVSLSQSL SQARALEGMD EAEYLVAQSE VASNRKAPTH EKRVILADHI       540
     AEENVGFRMP VHPPVRYTQK AQPVLGLEQD TRTHEEPVET HNERQLEDNT ALLEGSVDSH       600
     TTYSTSNMQQ KRKPTRAADG LFLTLHPLAN SSVRKRIYVN QGINPFFIGR SDECHYKIPD       660
     NRLSRIHCFF LKKRHPVGNS IYESPAQGLD DIWYCHNGTN VSYVNDMKLL PGTKVLLQDG       720
     DQVKVIWDKA QNITIAFRVE INDSAGLFNS AAVTQNARHI SQQTPDELAL AVSFIELMRT       780
     QMHAIHNSET PPADTGSCSA VAAGNDAAAS SILRKIHYST LSQVPMKKAK RAKLAQADRN       840
     EDSLQFL                                                                 847
//

If you have problems or comments...

PBIL Back to PBIL home page